NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300014104

3300014104: Human oral microbial communities of schizophrenia patients from Maryland, USA - ES_010



Overview

Basic Information
IMG/M Taxon OID3300014104 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0121296 | Gp0151528 | Ga0134356
Sample NameHuman oral microbial communities of schizophrenia patients from Maryland, USA - ES_010
Sequencing StatusPermanent Draft
Sequencing CenterThe George Washington University (GWU)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size20133404
Sequencing Scaffolds4
Novel Protein Genes4
Associated Families4

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
Not Available1
All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Neisseriales → Neisseriaceae → Neisseria1
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae1
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameHuman Oral Microbial Communities Of Schizophrenia Patients From Maryland, Usa
TypeHost-Associated
TaxonomyHost-Associated → Human → Digestive System → Oral Cavity → Throat → Human Oral → Human Oral Microbial Communities Of Schizophrenia Patients From Maryland, Usa

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Host-associated → Animal → Animal secretion

Location Information
LocationUSA: Maryland
CoordinatesLat. (o)N/ALong. (o)N/AAlt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F035108Metagenome173Y
F076912Metagenome117Y
F094706Metagenome105Y
F103431Metagenome101N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0134356_104472Not Available850Open in IMG/M
Ga0134356_105299All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Neisseriales → Neisseriaceae → Neisseria780Open in IMG/M
Ga0134356_106709All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae689Open in IMG/M
Ga0134356_107035All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum672Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0134356_104472Ga0134356_1044721F076912LEKSTPLCNGKGSNADKVQDSETSLLVSKKADKNYLDDSEGTQKSCLDVVFELLATTAGTSSSNSLPESVRLLESQLQVERHRSDVLRQEAEGLRKSLQNSDAYFLVQQQVLEDLSAKQEKVNKLAKHLASIMGTQDIVS*
Ga0134356_105299Ga0134356_1052991F103431MIDFDALIVGMLFFIQLFLQSIAWRVAIAHFLHAERGNAAAAAFDGAFGEDIADCHAEDDDDKDAE
Ga0134356_106709Ga0134356_1067091F094706VGLAHGGFEFLKGSFEGLKGYAVGRMTKSRRGKLYIDDAGWGPEAGSIEYGYRVPFGSIHVFIGKIGEPGPEPDIFTDLVETAQRARPARALPGLKRAFVGCVHGGLSEGSGSGDETAAGSDGESSTSNSLYQLQDGRLMGCSDGDSIPDLFEPPSQVGVFMAG
Ga0134356_107035Ga0134356_1070351F035108MLTGRPAEEMPGSTGDLLPELSQLHEQVRQVMQGVAQALWPSVSLLEGVAELAEKLKGARRRFRLWKISACRQGAREAWAMVKTRYKKADPNHMAEVGPVGPDGKEIPVSLVYGQVELAAKYSQQDCRLDI

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.