Sample 3300014236

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Sample 3300014236

3300014236: Indoor hospital air microbial communities from San Diego, USA - 176_L1_2014-5-5

Overview

Basic Information
IMG/M Taxon OID	3300014236 Open in IMG/M
GOLD Reference (Study \| Sequencing Project \| Analysis Project)	Gs0121326 \| Gp0152460 \| Ga0135128
Sample Name	Indoor hospital air microbial communities from San Diego, USA - 176_L1_2014-5-5
Sequencing Status	Permanent Draft
Sequencing Center	San Diego State University
Published?	N
Use Policy	Open

Dataset Contents
Total Genome Size	872750
Sequencing Scaffolds	1
Novel Protein Genes	1
Associated Families	1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Castanea → Castanea mollissima	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
Name	Indoor Hospital Air Microbial Communities From San Diego, Usa
Type	Environmental
Taxonomy	Environmental → Air → Indoor Air → Unclassified → Unclassified → Indoor Hospital Air → Indoor Hospital Air Microbial Communities From San Diego, Usa

Alternative Ecosystem Assignments
Environment Ontology (ENVO)	Unclassified
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Aerosol (non-saline)

Location Information
Location	USA: San Diego, California
Coordinates	Lat. (^o)	N/A	Long. (^o)	N/A	Alt. (m)	N/A	Depth (m)	N/A
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F049431	Metagenome / Metatranscriptome	146	N

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
Ga0135128_10069	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Castanea → Castanea mollissima	927	Open in IMG/M

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0135128_10069	Ga0135128_100691	F049431	VTILSPSAEAHERTPRRRPGCTGRKGRRRSEPQPQASQVCETPEPQATDSIAPTEFPKLRSATGGIRLLHRSLHRYIRPSGGEDSRQVNAQARVLDRAIPEDLVKRLAKPVIHRPQMLPANRETNRTSVPSTSTLRLPEGRQHRASRKESPSPK*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.