 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300014357 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0121343 | Gp0152886 | Ga0135352 |
| Sample Name | Human colon tissue microbial communities from Howard University Cancer Center, USA - CC0929 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | HiThru Analytics LLC |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 31743415 |
| Sequencing Scaffolds | 2 |
| Novel Protein Genes | 3 |
| Associated Families | 3 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium | 1 |
| All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Laurasiatheria → Artiodactyla → Ruminantia → Pecora → Bovidae → Bovinae → Bos → Bos indicus x Bos taurus | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Human Fecal And Colon Tissue Microbial Communities From Howard University Cancer Center, Usa |
| Type | Host-Associated |
| Taxonomy | Host-Associated → Human → Digestive System → Large Intestine → Unclassified → Human Colon Tissue → Human Fecal And Colon Tissue Microbial Communities From Howard University Cancer Center, Usa |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Animal → Animal proximal gut |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | USA: Washington, D.C | |||||||
| Coordinates | Lat. (o) | N/A | Long. (o) | N/A | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F001445 | Metagenome | 692 | Y |
| F047125 | Metagenome / Metatranscriptome | 150 | N |
| F078004 | Metagenome | 117 | N |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0135352_104105 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium | 1194 | Open in IMG/M |
| Ga0135352_112838 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Laurasiatheria → Artiodactyla → Ruminantia → Pecora → Bovidae → Bovinae → Bos → Bos indicus x Bos taurus | 592 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0135352_102763 | Ga0135352_1027631 | F078004 | LSSRNTDFLFRDLLFRKSSTGGLSAVAGSAALDVHMLRHTLIITIINALYRLTVDTDGMAWMRQRITERLSSLSLLRKALAAGAVTITGMLTSHHDVSLAAQTVLVIGTIFH |
| Ga0135352_104105 | Ga0135352_1041052 | F047125 | MDVALLLMVLGVMLSGFWAADALDHMRKEILQQEGKRRGWWS* |
| Ga0135352_112838 | Ga0135352_1128382 | F001445 | HFHALEKEMATHSSVLAWRIPGTGEPGGLPSMGSHRVGHD* |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |