Sample 3300014525

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Sample 3300014525

3300014525: Human fecal microbial communities from newborn in Denmark - 70_B

Overview

Basic Information
IMG/M Taxon OID	3300014525 Open in IMG/M
GOLD Reference (Study \| Sequencing Project \| Analysis Project)	Gs0127429 \| Gp0193858 \| Ga0169871
Sample Name	Human fecal microbial communities from newborn in Denmark - 70_B
Sequencing Status	Permanent Draft
Sequencing Center	Beijing Genomics Institute (BGI)
Published?	N
Use Policy	Open

Dataset Contents
Total Genome Size	66581715
Sequencing Scaffolds	1
Novel Protein Genes	1
Associated Families	1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
Name	Human Host-Associated Microbial Communities From Fecal Samples Of Mother And Infant In Denmark
Type	Host-Associated
Taxonomy	Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Host-Associated → Human Host-Associated Microbial Communities From Fecal Samples Of Mother And Infant In Denmark

Alternative Ecosystem Assignments
Environment Ontology (ENVO)	Unclassified
Earth Microbiome Project Ontology (EMPO)	Host-associated → Animal → Animal distal gut

Location Information
Location	Denmark
Coordinates	Lat. (^o)	55.678	Long. (^o)	12.531	Alt. (m)	N/A	Depth (m)	N/A
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F051936	Metagenome	143	N

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
Ga0169871_100462	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides	31484	Open in IMG/M

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0169871_100462	Ga0169871_1004627	F051936	MKQEGTGQVLFFPLALRGKALGFSVLQEHAVMTPVISIFFATLIIKYLSIHISIKK*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.