 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300014696 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0121297 | Gp0151577 | Ga0134405 |
| Sample Name | Human fecal microbial communities from obese patients in Germany - AS44_18 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | University of Hohenheim |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 54864383 |
| Sequencing Scaffolds | 3 |
| Novel Protein Genes | 3 |
| Associated Families | 3 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 1 |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Blautia → Blautia obeum | 1 |
| All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Human Fecal Microbial Communities From Obese Patients In Germany |
| Type | Host-Associated |
| Taxonomy | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Fecal → Human Fecal Microbial Communities From Obese Patients In Germany |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Animal → Animal distal gut |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Germany | |||||||
| Coordinates | Lat. (o) | N/A | Long. (o) | N/A | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F026592 | Metagenome / Metatranscriptome | 197 | Y |
| F056682 | Metagenome | 137 | Y |
| F106193 | Metagenome | 100 | N |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0134405_100644 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 11034 | Open in IMG/M |
| Ga0134405_105054 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Blautia → Blautia obeum | 1571 | Open in IMG/M |
| Ga0134405_114717 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 510 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0134405_100644 | Ga0134405_1006446 | F056682 | MKIQSRAGKVANQSIRQGEIYSASFGAFLSKNRSTFPIQELRKNRENQEVL* |
| Ga0134405_105054 | Ga0134405_1050541 | F026592 | ASPQGIAALAAQGGVATLTERSDATFSVGQFSSADRE* |
| Ga0134405_114717 | Ga0134405_1147171 | F106193 | AERERIERSMMNHSSSTVVSDREYASRSTAGCMVMQDPLQTMERDVVSIYRQVRTKGDGVGVSYLNMQKKIREWIKNLPYECPPDEEVQEMRKEILDGRSKHIKP* |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |