NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300014766

3300014766: Human oral microbial communities of schizophrenia patients from Maryland, USA - ES_114



Overview

Basic Information
IMG/M Taxon OID3300014766 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)		Gs0121296 | Gp0151509 | Ga0134337
Sample NameHuman oral microbial communities of schizophrenia patients from Maryland, USA - ES_114
Sequencing StatusPermanent Draft
Sequencing CenterThe George Washington University (GWU)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size98653097
Sequencing Scaffolds6
Novel Protein Genes6
Associated Families6

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Prevotellaceae → Alloprevotella → Alloprevotella sp. oral taxon 4731
All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Saccharibacteria → unclassified Saccharibacteria → TM7 phylum sp. oral taxon 3521
All Organisms → cellular organisms → Bacteria2
All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Saccharibacteria2

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameHuman Oral Microbial Communities Of Schizophrenia Patients From Maryland, Usa
TypeHost-Associated
TaxonomyHost-Associated → Human → Digestive System → Oral Cavity → Throat → Human Oral → Human Oral Microbial Communities Of Schizophrenia Patients From Maryland, Usa

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Host-associated → Animal → Animal secretion

Location Information
LocationUSA: Maryland
CoordinatesLat. (o)N/ALong. (o)N/AAlt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F028722Metagenome / Metatranscriptome190Y
F066860Metagenome126N
F085820Metagenome111N
F089055Metagenome109Y
F095630Metagenome105N
F103433Metagenome101N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0134337_100350All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Prevotellaceae → Alloprevotella → Alloprevotella sp. oral taxon 47322940Open in IMG/M
Ga0134337_100526All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Saccharibacteria → unclassified Saccharibacteria → TM7 phylum sp. oral taxon 35218617Open in IMG/M
Ga0134337_101063All Organisms → cellular organisms → Bacteria12229Open in IMG/M
Ga0134337_102617All Organisms → cellular organisms → Bacteria6103Open in IMG/M
Ga0134337_106051All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Saccharibacteria2796Open in IMG/M
Ga0134337_123767All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Saccharibacteria720Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0134337_100350Ga0134337_1003506F085820MRSTFYLFAVLFLATTFFSCETVEPSPRPTWGEIVNPIEAFMYPRDLKVFADGEEGRRWLILVVPDSTKSSFAPTSKSTPAEVARYKELSQLVGNPTEPVANECHFHRTWLTQGVKAIRVVRTQADGRDEEVTAQCGNLYFYTDKQIFDCQFKCGNRSIFAKPLGEVVEADYLWLPGIDVFGLLAPPNPDHLKQRIVLRLADGTEIEKELSEKGKK*
Ga0134337_100526Ga0134337_1005264F028722MATTVDNGQTCLEKRGIEERHKEITRSDYNIEDQYGPTHKDALSDGDPQGKGTGHGGHTHYLPDCTKPTGMIDYSNFDTEHGGGQYDIEGRNNISGRKRALAISMYNKENMYGPTIVDTSVNRSDGQYFVGQTTKHL*
Ga0134337_101063Ga0134337_1010639F103433MMFVMKEWSKNKPGVVFFFAVWFILSISFIGNFFGTGLWNGWFDGFQKDSSAIVEKTAYCKNKYDYKGPLIAADSKDYNKIMMSQDCNPSQVKPYVSQYGLQARVIAGLSPNDTSKIPAYIKRVSIFLAVLTAFLLALVVQKIRALFGGIAASVFTVMLSFSPWIAGYARNIYWIEPLLIAPFVISFVGYQYFKKSKKLWLFYIIESVAMFFKLLNGYEYVSTIAISVLVPIIFFELVHKNVKIINLWKQAVPVFAATVVAFFGAYWVNFVSLTDYYGSSDKAASAINARASDRGISGIRSMRAYAVGNFKILRPETYNFINQLVNLDNMANNSGKTYKYIIVNVVNYLLLPAITLPVHINGMFGEFVQSILFWTILGYLIILSSRKIIGKKYSRPFLWSMNFSVIGAFCWLALMPGHALPHAHINGIIFYIPLLLFVYVLIGLWADYVVKRTVKYE*
Ga0134337_102617Ga0134337_1026172F095630MIISSLYKTVENNGLLAHIYEHLLAQYVMKALQGRGLFISSDIILTAKTYGDTCFMDVEFYSPEAQDAYNEALRLFDKWDIPRSAALRAATECGIEMNRLVAELVQDELLHELSAVQSSPWRQQSDMTYRKADSKSSVNTLFHAPYIKYGLESKNLFPEYVLEYSVDEEYIQSPVDQALAAVVMQAVALNFLVMIRKKHTVYDRGDQWSEASKSVGYRTFLGISKKDDSIVHQLKNEFMEYVQFLSASPFCDNLQAALVRCSHNYEQVLLGRDTLNSILGGCVVGGRGWLEMADDTRIRKMIDLIEIDIYEIDY*
Ga0134337_106051Ga0134337_1060513F066860MTTKKQKLQKQQAIDTWIVIALWVSAIWFSFARGFITGIGGWVLALFAPWALIVSCICLAIISRQMKKRHASKDHLTTIVRASFIVMSISLFICGLAMPDFSDMETFSTLSVYTNNAISFKTSKTIAIISGFVVVLSLFVAVTFGIAEDKE*
Ga0134337_123767Ga0134337_1237672F089055RTFWHLKVEKMNSTPECVIKTPEIEAREKLAAIFSDAERCDNSKVNPELGKTAIDIENTSRMNSADDGAVYLCNQALGGYEKSLDYINNSPLEAVQAIGKSLQLFREDKTKESCR*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.