 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300014807 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0121297 | Gp0151611 | Ga0134439 |
| Sample Name | Human fecal microbial communities from obese patients in Germany - AS62_3 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | University of Hohenheim |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 146046008 |
| Sequencing Scaffolds | 2 |
| Novel Protein Genes | 2 |
| Associated Families | 2 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Coriobacteriia → Coriobacteriales → Coriobacteriaceae → Collinsella → Collinsella tanakaei | 1 |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Human Fecal Microbial Communities From Obese Patients In Germany |
| Type | Host-Associated |
| Taxonomy | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Fecal → Human Fecal Microbial Communities From Obese Patients In Germany |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Animal → Animal distal gut |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Germany | |||||||
| Coordinates | Lat. (o) | N/A | Long. (o) | N/A | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F032286 | Metagenome / Metatranscriptome | 180 | Y |
| F099269 | Metagenome | 103 | N |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0134439_1001810 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Coriobacteriia → Coriobacteriales → Coriobacteriaceae → Collinsella → Collinsella tanakaei | 6661 | Open in IMG/M |
| Ga0134439_1004974 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia | 3197 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0134439_1001810 | Ga0134439_10018107 | F099269 | MLLVDDLGDRASGASVLAGAAGNAGILVSDGSDVVELQNTSGASVNANATSDALVGINYGMSHGSFLSIVRCA* |
| Ga0134439_1004974 | Ga0134439_10049744 | F032286 | MFLLFFSMRSMVKWVCQIVTPVRHRALVFDARLSAGNTTDDALVTGGTFHFCRLMCLCVKRRNIMLNDKRRSLLNSALFRADNRTGQKTISPFSLALILTFDFAALSEHRSCPEDRSRRFVLLGALDAALRQRTYPVRTVMQFSRFRCDCKTILAKNIALTRISKRSENAPKNANFHAYGQDRKGQKFEGRTPLCNQNSPFRNGSKTCA* |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |