Sample 3300014928

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Sample 3300014928

3300014928: Human fecal microbial community of Hadza hunter-gatherer populations from Tanzania - 10007

Overview

Basic Information
IMG/M Taxon OID	3300014928 Open in IMG/M
GOLD Reference (Study \| Sequencing Project \| Analysis Project)	Gs0121306 \| Gp0151740 \| Ga0134568
Sample Name	Human fecal microbial community of Hadza hunter-gatherer populations from Tanzania - 10007
Sequencing Status	Permanent Draft
Sequencing Center	University of Bologna
Published?	N
Use Policy	Open

Dataset Contents
Total Genome Size	44531531
Sequencing Scaffolds	1
Novel Protein Genes	1
Associated Families	1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
Not Available	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
Name	Human Fecal Microbial Community Of Hadza Hunter-Gatherer And Regular Subjects From Tanzania And Italy
Type	Host-Associated
Taxonomy	Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Fecal → Human Fecal Microbial Community Of Hadza Hunter-Gatherer And Regular Subjects From Tanzania And Italy

Alternative Ecosystem Assignments
Environment Ontology (ENVO)	Unclassified
Earth Microbiome Project Ontology (EMPO)	Host-associated → Animal → Animal distal gut

Location Information
Location	Tanzania
Coordinates	Lat. (^o)	-3.6347588	Long. (^o)	35.0828588	Alt. (m)	N/A	Depth (m)	N/A
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F047125	Metagenome / Metatranscriptome	150	N

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
Ga0134568_114706	Not Available	631	Open in IMG/M

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0134568_114706	Ga0134568_1147061	F047125	MDVVLLLMVLGVMLSGFWAADALDHMRREILQQEGKRRGWWS*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.