 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300014937 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0121306 | Gp0151737 | Ga0134565 |
| Sample Name | Human fecal microbial community of Hadza hunter-gatherer populations from Tanzania - 10004 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | University of Bologna |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 61355099 |
| Sequencing Scaffolds | 2 |
| Novel Protein Genes | 2 |
| Associated Families | 2 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → unclassified Oscillospiraceae → Ruminococcaceae bacterium D5 | 1 |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Human Fecal Microbial Community Of Hadza Hunter-Gatherer And Regular Subjects From Tanzania And Italy |
| Type | Host-Associated |
| Taxonomy | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Fecal → Human Fecal Microbial Community Of Hadza Hunter-Gatherer And Regular Subjects From Tanzania And Italy |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Animal → Animal distal gut |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Tanzania | |||||||
| Coordinates | Lat. (o) | -3.6347588 | Long. (o) | 35.0828588 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F056682 | Metagenome | 137 | Y |
| F068941 | Metagenome | 124 | N |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0134565_102937 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → unclassified Oscillospiraceae → Ruminococcaceae bacterium D5 | 2528 | Open in IMG/M |
| Ga0134565_113896 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 847 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0134565_102937 | Ga0134565_1029374 | F056682 | MKTQSRAGKAANQPIRQGEKYSASFGAFPSKNRITFPIQELGKIHENQEVL* |
| Ga0134565_113896 | Ga0134565_1138961 | F068941 | MKDGENFCSKCGNKVETKENKQESKNNTKEPATKSKKGLIIGIIGLIIVMIGGTYAYYRWNSTSNINVSVKISGNTVTFVGGSNVTGTLTPVDSKEEGIKKDITVKANEAGSTMSLYMELTTMPSELKEESFVYELYYNDTTLVKKGNFKAYNASSNASGITYASSGVTTLTLFTDRNVNTTTDKYTLYLWFNGKDFTNPDTMQNKTLSFNLYATGKNATLNG* |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |