Sample 3300014943

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Sample 3300014943

3300014943: Human fecal microbial community of Hadza hunter-gatherer populations from Tanzania - 10027

Overview

Basic Information
IMG/M Taxon OID	3300014943 Open in IMG/M
GOLD Reference (Study \| Sequencing Project \| Analysis Project)	Gs0121306 \| Gp0151735 \| Ga0134563
Sample Name	Human fecal microbial community of Hadza hunter-gatherer populations from Tanzania - 10027
Sequencing Status	Permanent Draft
Sequencing Center	University of Bologna
Published?	N
Use Policy	Open

Dataset Contents
Total Genome Size	73917178
Sequencing Scaffolds	1
Novel Protein Genes	1
Associated Families	1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
Name	Human Fecal Microbial Community Of Hadza Hunter-Gatherer And Regular Subjects From Tanzania And Italy
Type	Host-Associated
Taxonomy	Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Fecal → Human Fecal Microbial Community Of Hadza Hunter-Gatherer And Regular Subjects From Tanzania And Italy

Alternative Ecosystem Assignments
Environment Ontology (ENVO)	Unclassified
Earth Microbiome Project Ontology (EMPO)	Host-associated → Animal → Animal distal gut

Location Information
Location	Tanzania
Coordinates	Lat. (^o)	-3.6347588	Long. (^o)	35.0828588	Alt. (m)	N/A	Depth (m)	N/A
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F029444	Metagenome	188	Y

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
Ga0134563_108429	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes	1423	Open in IMG/M

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0134563_108429	Ga0134563_1084292	F029444	MGVSEQLTGFELEDLMSWTVSNLQRPFREDFSLEISGIIAEKESQIFGRRFVGFDS*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.