NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300014966

3300014966: Freshwater microbial mat microbial communities from Canadian High Arctic Lake, Ward Hunt Island, Canada - Sample WHa



Overview

Basic Information
IMG/M Taxon OID3300014966 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)		Gs0128895 | Gp0209085 | Ga0182824
Sample NameFreshwater microbial mat microbial communities from Canadian High Arctic Lake, Ward Hunt Island, Canada - Sample WHa
Sequencing StatusPermanent Draft
Sequencing CenterLaval University
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size817233659
Sequencing Scaffolds6
Novel Protein Genes6
Associated Families5

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria1
All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA61
Not Available2
All Organisms → cellular organisms → Bacteria → Acidobacteria2

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameMicrobial Mat Communities From High Arctic Lakes
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Microbial Mat → Microbial Mat Communities From High Arctic Lakes

Alternative Ecosystem Assignments
Environment Ontology (ENVO)freshwater lake biome → freshwater lake → microbial mat material
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Surface (non-saline)

Location Information
LocationCanada: Ward Hunt Island
CoordinatesLat. (o)83.079722Long. (o)-74.138056Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F008147Metagenome / Metatranscriptome338Y
F037916Metagenome167Y
F055342Metagenome / Metatranscriptome138Y
F068999Metagenome / Metatranscriptome124Y
F093152Metagenome106Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0182824_10008804All Organisms → cellular organisms → Bacteria1758Open in IMG/M
Ga0182824_10013549All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA61393Open in IMG/M
Ga0182824_10014595Not Available1339Open in IMG/M
Ga0182824_10028401All Organisms → cellular organisms → Bacteria → Acidobacteria929Open in IMG/M
Ga0182824_10030666All Organisms → cellular organisms → Bacteria → Acidobacteria891Open in IMG/M
Ga0182824_10057105Not Available615Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0182824_10008804Ga0182824_100088043F093152SGTRYSHNYASLRSLVNLVTKDWNARGLMPTGYRLTICPPVVFNLIGTVFHPEWSRTESLELGFYRDSGDNAKCYAVGSNAPEDFSYIKEVETESDWAILGFRTALVPE*
Ga0182824_10013549Ga0182824_100135492F008147MSIEEAILDTVRRLPPTQQEQVLRFADGLQREPKITMVPSRDRRREIKWIKDNRTAYADQWVVVEGDRLIAANADGHKAFADAKEAGIDVPFLVHVLQEDSLPFVAGW*
Ga0182824_10014595Ga0182824_100145951F037916GSAVALKRDAQRKPRRDDVETRHKAEIDRLRAVITEITTENLELKKKI*
Ga0182824_10028401Ga0182824_100284013F055342MSKKQRTKYYVRKRIFLNRDLDMRAFAIAIVEDTRHFPNESDGEWKWGEIQLNLGDCYRHVSFDFTMDTKAHRADSLYKIRKIAEIVNAVRDALELEAESINQRQNDQPKVKAKPKAKGAAG*
Ga0182824_10030666Ga0182824_100306661F055342MFLNRDLDMRAFAIGIVEDTRHIPNDDEEGWKWRTIELTLGDCYRQVSFDFDLSSKETRSKSLYKIRRIAEIVNRVCAAIEIEAKSVDERKIVKPKAAPKAKSAAG*
Ga0182824_10057105Ga0182824_100571051F068999MRGSGWLAAVVVAGWSQAALAAEMLPLKQGIYVPVNRPCKGASNAEMLNYRGEKSSFGSAQAACTIVKMTRRGNVFTITDKCVDIRGGGDIEGGPVVVTIASPTGFSKDGERYRYCGPRAQF*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.