NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300017562

3300017562: Hotspring sediment microbial communities from Obsidian Pool, Yellowstone National Park, Wyoming, USA ? Obsidian 3. Combined Assembly of Gp0212718, Gp0212717



Overview

Basic Information
IMG/M Taxon OID3300017562 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)		Gs0128960 | Gp0212717 | Ga0186926
Sample NameHotspring sediment microbial communities from Obsidian Pool, Yellowstone National Park, Wyoming, USA ? Obsidian 3. Combined Assembly of Gp0212718, Gp0212717
Sequencing StatusPermanent Draft
Sequencing CenterStanford University
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size65673855
Sequencing Scaffolds3
Novel Protein Genes3
Associated Families2

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → Aquificae → Aquificae → Aquificales → Hydrogenothermaceae → Sulfurihydrogenibium → Sulfurihydrogenibium yellowstonense1
All Organisms → cellular organisms → Bacteria1
All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Hyperthermophilic Archaeal Virus 11

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameYellowstone National Park Obsidian Pool Microbial Communities
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Hot Spring Sediment → Yellowstone National Park Obsidian Pool Microbial Communities

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Unclassified

Location Information
LocationYNP, Wyoming, USA
CoordinatesLat. (o)44.428Long. (o)-110.5885Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000750Metagenome / Metatranscriptome908Y
F043237Metagenome / Metatranscriptome156Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0186926_11546All Organisms → cellular organisms → Bacteria → Aquificae → Aquificae → Aquificales → Hydrogenothermaceae → Sulfurihydrogenibium → Sulfurihydrogenibium yellowstonense9084Open in IMG/M
Ga0186926_15636All Organisms → cellular organisms → Bacteria5494Open in IMG/M
Ga0186926_15847All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Hyperthermophilic Archaeal Virus 15188Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0186926_11546Ga0186926_115462F043237MELRRTARYIAQLSGHGYKYAVVGKLARYDKKLVKRLEYEGFVFYLCRFQTKKEVVEYCLERAEGTFRVYCLASKPLEFPNAPLKLWYDEKNQRLKLLARRSFINECLRVIERASSLKYPNHKLYTAKVNEALRNLYSILAYTYNDKERIQAIKRKVKHLFVEALKENYGIEPKKAMEDYRRFVLKFSDVLKRKQRTNSSTS
Ga0186926_15636Ga0186926_156361F043237MELRRTARYIAQLSGHGYKYAVVGKLARYDKKLVKRLEYEGFVFYLCRFQTKKEVVEYCLERAEGTFRVYCLASKPLEFPNAPLKLWYDEKNQRLKLLARRSFINECLRVIERASSLKYPNHKLYTAKVNEALRNLYSILAYTYNDKERIRAIKRKVKHLFVEALKENYGIEPKKAMEDYRRFVLKFSDVLKRKQRTNSSTS
Ga0186926_15847Ga0186926_158472F000750MIASIVVTAVLFSYWLYKKLAKPKTFQFPIDVQTGDVIHSAFGSLLANLSMQGHLFDVAVGVVLYLAYQIFDWTVKKDTIYKDVATFTAGYFITLTAKYIPV
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.