x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our
privacy policy.
OK
Sample 3300020148
3300020148: Enriched microbial communities from leaf-cutter ant dump, University of Wisconsin, Madison, United States - 1B5A
Overview
Basic Information |
IMG/M Taxon OID | 3300020148 Open in IMG/M |
GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0121620 | Gp0224296 | Ga0206103 |
Sample Name | Enriched microbial communities from leaf-cutter ant dump, University of Wisconsin, Madison, United States - 1B5A |
Sequencing Status | Permanent Draft |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Published? | N |
Use Policy | Open |
Dataset Contents |
Total Genome Size | 99929319 |
Sequencing Scaffolds | 1 |
Novel Protein Genes | 1 |
Associated Families | 1 |
Dataset Phylogeny |
Taxonomy Groups | Number of Scaffolds |
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Devosiaceae → Devosia | 1 |
Ecosystem and Geography
Ecosystem Assignment (GOLD) |
Name | Characterization Of Biomass-Degrading Enzymes From Insect-Associated, Soil, And Chicken Feces Microbial Communities |
Type | Host-Associated |
Taxonomy | Host-Associated → Arthropoda → Ant Dump → Unclassified → Unclassified → Ant Dump → Characterization Of Biomass-Degrading Enzymes From Insect-Associated, Soil, And Chicken Feces Microbial Communities |
Alternative Ecosystem Assignments |
Environment Ontology (ENVO) | Unclassified |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) |
Location Information |
Location | USA: Wisconsin |
Coordinates | Lat. (o) | 43.0758 | Long. (o) | -89.4125 | Alt. (m) | N/A | Depth (m) | N/A |
Location on Map |
|
Zoom: |
Powered by OpenStreetMap © |
Associated Families
Family | Category | Number of Sequences | 3D Structure? |
F099558 | Metagenome / Metatranscriptome | 103 | Y |
Associated Scaffolds
Scaffold | Taxonomy | Length | IMG/M Link |
---|
Ga0206103_108280 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Devosiaceae → Devosia | 1452 | Open in IMG/M |
Sequences
Scaffold ID | Protein ID | Family | Sequence |
Ga0206103_108280 | Ga0206103_1082801 | F099558 | MSFSNSTYEATPSVTRRDRHVVSRLVSAIFSQWPERVRGSPPLPNHLRRDIGLPPIYEPPSHWNYYR |