NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300021974

3300021974: Hydrothermal fluids microbial communities from Mariana Back-Arc Basin vent fields, Pacific Ocean - Perseverance_FS929 _150kmer



Overview

Basic Information
IMG/M Taxon OID3300021974 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)		Gs0129105 | Gp0216780 | Ga0232645
Sample NameHydrothermal fluids microbial communities from Mariana Back-Arc Basin vent fields, Pacific Ocean - Perseverance_FS929 _150kmer
Sequencing StatusPermanent Draft
Sequencing CenterMarine Biological Laboratory
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size472881746
Sequencing Scaffolds9
Novel Protein Genes9
Associated Families8

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
Not Available2
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobulbaceae1
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1
All Organisms → cellular organisms → Bacteria1
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1
All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium1
All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Dependentiae → unclassified Candidatus Dependentiae → Candidatus Dependentiae bacterium ADurb.Bin3311
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Kanaloavirus → unclassified Kanaloavirus → Kanaloavirus sp.1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameCharacterization Of Microbial Community From Mariana Back Arc
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Hydrothermal Vent Fluids → Characterization Of Microbial Community From Mariana Back Arc

Alternative Ecosystem Assignments
Environment Ontology (ENVO)marine hydrothermal vent biome → marine hydrothermal vent → hydrothermal fluid
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Subsurface (non-saline)

Location Information
LocationPerseverance vent field, Mariana back arc basin
CoordinatesLat. (o)15.47990499Long. (o)144.50763029Alt. (m)N/ADepth (m)3912
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002883Metagenome / Metatranscriptome523Y
F013484Metagenome / Metatranscriptome271Y
F026445Metagenome / Metatranscriptome198Y
F030941Metagenome184Y
F036294Metagenome / Metatranscriptome170Y
F052414Metagenome142Y
F077283Metagenome / Metatranscriptome117Y
F079636Metagenome115Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0232645_1001543Not Available5316Open in IMG/M
Ga0232645_1003969All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobulbaceae3781Open in IMG/M
Ga0232645_1008373All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria2821Open in IMG/M
Ga0232645_1010268Not Available2585Open in IMG/M
Ga0232645_1022307All Organisms → cellular organisms → Bacteria1834Open in IMG/M
Ga0232645_1047262All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1279Open in IMG/M
Ga0232645_1164242All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium703Open in IMG/M
Ga0232645_1172847All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Dependentiae → unclassified Candidatus Dependentiae → Candidatus Dependentiae bacterium ADurb.Bin331687Open in IMG/M
Ga0232645_1305850All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Kanaloavirus → unclassified Kanaloavirus → Kanaloavirus sp.532Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0232645_1001543Ga0232645_10015437F030941MLTFLLTALIVFMSVPAAFGLLVFFHVFVRKKTSPADASNRINHFRLVWFALTREEKFVDVFPWMKNDEMENIENKSETRNQP
Ga0232645_1003969Ga0232645_10039692F036294VAVMDKGFADEAVVGVKLLADDDAVTYQRIKLTENDREVGAEGWNM
Ga0232645_1008373Ga0232645_10083732F036294VTVTDKGFSDEAIVGVKLVADEDAVTYLRIKLSASDKEVGAKGWNM
Ga0232645_1010268Ga0232645_10102682F013484MNVSLDLSECTLSTEHQAIVDALNKLLSWLPDDKNPEAALRLALLVLEAADVAPQAVLARAVGLSQDRSVRVYKQRLRQEGLSGLFDHPIPGRPAITTRTAVERSLLQVILEAVIQEHTLPSDAQLAERVNQRLRQAQEPEAEQVTASMVETIRLRWGIQRPVMAQQFQAAPPTPPEEERVRLGRTQVGGAFILAVLLVETGWLKAAQLLPMAAGYAVTATQWLLTALFAVIFGVRRAFHLDDVRDIGFALVTGRARPLSHGTFQHLLHAIPADKAQAFYAETARREVQALGEGDRRVSVDGHNLPRYTHLVDLVKGKIGNTGRILKAEELVLAYDLDAHRWLALRVYQGTKELSKGVVEIVQELRRHRGDRRGLLSIFMDKGGYSGLVFRPLDAEERVLFYIPAVRYPANVEQWEQLQDADFDAEPFTYDKHADLPADQRPAYRLADIEMEVNVREGRKVVGTVTLRAIVLHNPHGEKPAERWPVVLLTNDRKSDARTLLNEYGDHWGQEFAHRIGRHDLCLDILPPGYVLTTRRDEQGRIVRKVEYDDTAFFLSAWLRSLVFNLMTDFAQTLGGKYARMWAGTLLRKFIRRPATLYLVDKELHVVFDPFPGQDELQPLLERLNAQRTALPWLNGLVVQFH
Ga0232645_1022307Ga0232645_10223071F079636DHPNVTAADGTVSSLGETQILGFDLSENDSLVMPIRSEYRAIDDPTILRSQKQGFFGWAELGFACLDSRMLGMGVIDRSL
Ga0232645_1047262Ga0232645_10472621F026445ERQIEYYDGRQESVEIIRVRCLECKKVFTVQPSFVVRYKRQETDAIEKLMTLLFITEDSYRMAGVSQALGMDTRQEGTWVALEEKQATAIQPLALWGLVQWMGQLSPAQLNLALGVDPPEYIIEDEKHVKEEGEKAYVPMIYAAEEALIWWVDYLYSASEDELKASFERFKALSDRLGQIVGATVDGWEAAQNALRETFSGITLEECHFHALLSLSKHLATYKRKQKAEGAPISEEQEKIIRNAFIRVLTAPTSESYQQALDELPDAFEDPPLASRKQSLIEKQSLFQAWVEDSRLVVVTTALDQCMKFLNRKFENMQTFRGPKSGLATVNAWAITRNCWRFLKGAKRAGLSPLELAGANFLGIPWMQIVNLVLSAWPTVPLVASVLYPST
Ga0232645_1164242Ga0232645_11642422F052414KTEARIETIRHKMDEIPAMLDGALLTKRNRVSRKDGSVYISPEYYTFQYRGSDGKRRWKRIPKKALASVKKLVRAAKRYRELEREYTALVTEISVAGRKKGGD
Ga0232645_1172847Ga0232645_11728471F077283MSNAEQVAHEKMLRDCENSMFGGDVHDVETPVHVWIDAKRESPIVAQMVWVAVPNVVTCRYQVILCYMDSDEQWRDAGGVLMFRRVSFWQYADVPECEVLC
Ga0232645_1305850Ga0232645_13058502F002883NLIFMSTLHHEDLLLTIFEEVQENFPYLDEEKQIEIANNRFQELCQ
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.