Basic Information | |
---|---|
IMG/M Taxon OID | 3300023047 Open in IMG/M |
GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0116274 | Gp0272179 | Ga0233376 |
Sample Name | Fecal eukaryotic communites from dung pellets of Tule Elk in California, USA - Elk Dung E2 |
Sequencing Status | Permanent Draft |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Published? | N |
Use Policy | Open |
Dataset Contents | |
---|---|
Total Genome Size | 97370596 |
Sequencing Scaffolds | 2 |
Novel Protein Genes | 2 |
Associated Families | 2 |
Dataset Phylogeny | |
---|---|
Taxonomy Groups | Number of Scaffolds |
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales | 1 |
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae | 1 |
Ecosystem Assignment (GOLD) | |
---|---|
Name | Fecal Eukaryotic Communites From Dung Pellets Of Tule Elk In California, Usa |
Type | Host-Associated |
Taxonomy | Host-Associated → Mammals → Digestive System → Large Intestine → Fecal → Elk Feces → Fecal Eukaryotic Communites From Dung Pellets Of Tule Elk In California, Usa |
Alternative Ecosystem Assignments | |
---|---|
Environment Ontology (ENVO) | Unclassified |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Animal → Animal distal gut |
Location Information | ||||||||
---|---|---|---|---|---|---|---|---|
Location | USA: California | |||||||
Coordinates | Lat. (o) | 38.04 | Long. (o) | -122.5 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F041521 | Metagenome | 159 | Y |
F072921 | Metagenome / Metatranscriptome | 120 | Y |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
Ga0233376_1000380 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales | 7940 | Open in IMG/M |
Ga0233376_1027460 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae | 679 | Open in IMG/M |
Scaffold ID | Protein ID | Family | Sequence |
---|---|---|---|
Ga0233376_1000380 | Ga0233376_10003807 | F041521 | SFSNTNAQTTLENCLFAGKFEKGNNLTDEAFLGAFGTLRSVKAIKNCYYLADDGLAAVHSDSNLKPGSDNVEITAVTEDDLRNNTIATQLGTLWEQGENYPVIRR |
Ga0233376_1027460 | Ga0233376_10274602 | F072921 | MRIRRIRQIELQMKSRLILTTDRKSASEGEYIEIRWACDACPDSLFLSIDSGCTQYSIAVSDSGVTRIPIPRSNGKMTVKLIGVISGKKVTESIDVRVKATKKAGTKAPLSSRMKMFGEKMQAKWYVFRANIKYWWLSQKKWQKALWIALLALWLGLLFSSIGRKPEVKVSSDKIQTAYIFS |
⦗Top⦘ |