Sample 3300023053

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Sample 3300023053

3300023053: Enriched soil aggregate microbial communities from Iowa State University, Ames, United States - MC6-MC0898-MG

Overview

Basic Information
IMG/M Taxon OID	3300023053 Open in IMG/M
GOLD Reference (Study \| Sequencing Project \| Analysis Project)	Gs0114432 \| Gp0238651 \| Ga0213827
Sample Name	Enriched soil aggregate microbial communities from Iowa State University, Ames, United States - MC6-MC0898-MG
Sequencing Status	Permanent Draft
Sequencing Center	DOE Joint Genome Institute (JGI)
Published?	N
Use Policy	Open

Dataset Contents
Total Genome Size	287424359
Sequencing Scaffolds	1
Novel Protein Genes	1
Associated Families	1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
Name	Enriched Soil Aggregate Microbial Communities From Iowa State University To Study Microbial Drivers Of Carbon Cycling
Type	Environmental
Taxonomy	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Enriched Soil Aggregate → Enriched Soil Aggregate Microbial Communities From Iowa State University To Study Microbial Drivers Of Carbon Cycling

Alternative Ecosystem Assignments
Environment Ontology (ENVO)	terrestrial biome → research facility → soil
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Soil (non-saline)

Location Information
Location	USA: Iowa
Coordinates	Lat. (^o)	42.0	Long. (^o)	-93.0	Alt. (m)	N/A	Depth (m)	N/A
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F030941	Metagenome	184	Y

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
Ga0213827_1000024	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales	268458	Open in IMG/M

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0213827_1000024	Ga0213827_100002446	F030941	MIALLLALLVGLMFLPALIGLFLIWHVVRPQKAPADTSNRINKIRLIWFVLTRENLFTGVFGWLKHDELDNVTPYQ

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.