Sample 3300023080

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Sample 3300023080

3300023080: Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L043-104R-2

Overview

Basic Information
IMG/M Taxon OID	3300023080 Open in IMG/M
GOLD Reference (Study \| Sequencing Project \| Analysis Project)	Gs0095510 \| Gp0290903 \| Ga0247733
Sample Name	Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L043-104R-2
Sequencing Status	Permanent Draft
Sequencing Center	DOE Joint Genome Institute (JGI)
Published?	N
Use Policy	Open

Dataset Contents
Total Genome Size	358656612
Sequencing Scaffolds	2
Novel Protein Genes	2
Associated Families	2

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria → Proteobacteria	1
Not Available	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
Name	Soil Microbial Communities From Arlington Agricultural Research Station In Wisconsin And Kellogg Biological Station In Michigan, Replicating The Bioenergy Cropping Systems Trials (Bcsts)
Type	Environmental
Taxonomy	Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter → Soil Microbial Communities From Arlington Agricultural Research Station In Wisconsin And Kellogg Biological Station In Michigan, Replicating The Bioenergy Cropping Systems Trials (Bcsts)

Alternative Ecosystem Assignments
Environment Ontology (ENVO)	terrestrial biome → agricultural field → plant litter
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Soil (non-saline)

Location Information
Location	USA: Wisconsin
Coordinates	Lat. (^o)	43.3	Long. (^o)	-89.38	Alt. (m)	N/A	Depth (m)	0
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F050725	Metagenome / Metatranscriptome	145	Y
F065927	Metagenome	127	Y

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
Ga0247733_1011591	All Organisms → cellular organisms → Bacteria → Proteobacteria	1654	Open in IMG/M
Ga0247733_1069923	Not Available	782	Open in IMG/M

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0247733_1011591	Ga0247733_10115912	F065927	MDPNHRPVLKSIESSPVRSFQALDHFVTSGGMRVTYYALSLDKVPADFFADPDGAWTYELLSRAAGFSSHSGVAIGALTSEFNGHPEGAAVVTLDALTRPYVAIVECPIAYHYVEQAESSASSAA
Ga0247733_1069923	Ga0247733_10699231	F050725	HEAVTGNLHDFASLCTEKSVQKLLSTERHENTLARLKSRSSIRSQNLMMACSMPHASDWLLAPPVAGLGLGLQSNVFRTALKFRLGIPLFDLPSACPALSSGGSVCGSEMDVFGDHALCCHNGPSLLFRHNNIRDILGHSARAAGLAAVVIEKKNQIEGSRAKPGDITVQQYHRGFASSAFDVTISHPLQKKFIEIAMEEAGMAAKGAHDRKVIKSLQECKDEGIHFVPLAWESIGGATETVHETIRKWTELEGARGGYP

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.