Basic Information | |
---|---|
IMG/M Taxon OID | 3300023099 Open in IMG/M |
GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0095510 | Gp0290973 | Ga0247803 |
Sample Name | Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L014-104B-1 |
Sequencing Status | Permanent Draft |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Published? | N |
Use Policy | Open |
Dataset Contents | |
---|---|
Total Genome Size | 637855321 |
Sequencing Scaffolds | 4 |
Novel Protein Genes | 4 |
Associated Families | 4 |
Dataset Phylogeny | |
---|---|
Taxonomy Groups | Number of Scaffolds |
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Rotaria | 1 |
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Castanea → Castanea mollissima | 1 |
Not Available | 2 |
Ecosystem Assignment (GOLD) | |
---|---|
Name | Soil Microbial Communities From Arlington Agricultural Research Station In Wisconsin And Kellogg Biological Station In Michigan, Replicating The Bioenergy Cropping Systems Trials (Bcsts) |
Type | Environmental |
Taxonomy | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter → Soil Microbial Communities From Arlington Agricultural Research Station In Wisconsin And Kellogg Biological Station In Michigan, Replicating The Bioenergy Cropping Systems Trials (Bcsts) |
Alternative Ecosystem Assignments | |
---|---|
Environment Ontology (ENVO) | terrestrial biome → agricultural field → plant litter |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) |
Location Information | ||||||||
---|---|---|---|---|---|---|---|---|
Location | USA: Wisconsin | |||||||
Coordinates | Lat. (o) | 43.3 | Long. (o) | -89.38 | Alt. (m) | N/A | Depth (m) | 0 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F034190 | Metagenome / Metatranscriptome | 175 | Y |
F041209 | Metagenome / Metatranscriptome | 160 | Y |
F045048 | Metagenome / Metatranscriptome | 153 | Y |
F049431 | Metagenome / Metatranscriptome | 146 | N |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
Ga0247803_1098992 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Rotaria | 1016 | Open in IMG/M |
Ga0247803_1112203 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Castanea → Castanea mollissima | 946 | Open in IMG/M |
Ga0247803_1176821 | Not Available | 731 | Open in IMG/M |
Ga0247803_1218235 | Not Available | 648 | Open in IMG/M |
Scaffold ID | Protein ID | Family | Sequence |
---|---|---|---|
Ga0247803_1098992 | Ga0247803_10989922 | F041209 | VSSAACEEIAELRRKLQRKRIGHVLFLDETALRLSAAPLRTLVLPHQQPYVVATETSTYAARFDMIACCTSDRVLIPKIFTPSERKGADVKGINGPMLKQFINDILAQAVERLDRYPLTLVLDKAAIHKNTEALLQEFYDRGSQSIKEILLMPPNAAKRMSPLDNALFHDWKEECRKHPPATKKTIQRIMSDAWNKMKPKSHYKHCGLTRNVDPYFDCPAPDIHRHGS |
Ga0247803_1112203 | Ga0247803_11122031 | F049431 | EAREQTPRGRPGCTGRKGRRRSEPQPQASEVCETPKPQATDSIAPTEFPKLRSATGGIRLLHRSLHRYIRPSGGEDSRQVNAQARVLDRAIPEDLVKRLAKPVIHRPQMLPANRETSRTSVPSTSTLQLPEGGQHRASRKESPSPK |
Ga0247803_1176821 | Ga0247803_11768212 | F045048 | SRASIPIGGHIAPNSTAGERALWKNVQNMAKKNKASDTINKPTPMFNPLCTDKVWLPK |
Ga0247803_1218235 | Ga0247803_12182351 | F034190 | LHELNGPEISKFIKQERSTGALAAAGASTSLTDSVKASHSVLSRWLQQLHHSLLRSGDWTSADIDAWRAAVDDIQQHWRAEAQSKPFPKLHMLRHSVEFAERHRFLGRASEAQIESHHAAFNALFHKQHRNQSGNVSERLRRSLADAALRAVQPFLQQ |
⦗Top⦘ |