NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300023200

3300023200: Activated sludge enriched bacterial communities from WWTP in Fort Collins, Colorado, USA ? LHP



Overview

Basic Information
IMG/M Taxon OID3300023200 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0133503 | Gp0295767 | Ga0256611
Sample NameActivated sludge enriched bacterial communities from WWTP in Fort Collins, Colorado, USA ? LHP
Sequencing StatusFinished
Sequencing CenterArgonne National Laboratory
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size174807749
Sequencing Scaffolds1
Novel Protein Genes3
Associated Families2

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Rotaria1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NamePpcp Degradation By Aerobic Enrichment Cultures (Carbon Source)
TypeEngineered
TaxonomyEngineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge → Ppcp Degradation By Aerobic Enrichment Cultures (Carbon Source)

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Water (non-saline)

Location Information
LocationFort Collins, Colorado, USA
CoordinatesLat. (o)40.585258Long. (o)-105.084419Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F041209Metagenome / Metatranscriptome160Y
F093130Metagenome / Metatranscriptome106Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0256611_1182390All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Rotaria1536Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0256611_1016824Ga0256611_10168241F093130QVRVFDSRGLRSHGLLGQTWRQTTYPNAIKHVQGEVDDYVIREGDVFGDSFVYNAFN
Ga0256611_1182390Ga0256611_11823901F041209MRRKLQKIGRKHVLFLDETALRLSEAATHTIVLPGEQPFVLATETTSYSARYDMIACCVGDRVLVPKIFSPAERKGADVRGINRAMLLQFVDDVLAQAVEGLDRYPLTLVLDRATVHKNVDVLRQAFADRASESIKDILLMPANAAKRMSPLDNALFHDWKEECRKHTPATKRTIVRIMSDAWNKMKPGPHYKHAGLVRGQDPYFDCPAPDVHRHGE
Ga0256611_1238091Ga0256611_12380912F093130MYLNQKVHVSDKRSLRSHGLLGQTWRKATYPNAIKHVQGVVDDYVIREADVFGDSFVYNAFN

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.