NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300024051

3300024051: Enriched microbial communities from leaf-cutter ant dump, University of Wisconsin, Madison, United States - 3A0



Overview

Basic Information
IMG/M Taxon OID3300024051 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0121620 | Gp0224308 | Ga0222423
Sample NameEnriched microbial communities from leaf-cutter ant dump, University of Wisconsin, Madison, United States - 3A0
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size237192996
Sequencing Scaffolds2
Novel Protein Genes2
Associated Families2

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1
All Organisms → cellular organisms → Bacteria1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameCharacterization Of Biomass-Degrading Enzymes From Insect-Associated, Soil, And Chicken Feces Microbial Communities
TypeHost-Associated
TaxonomyHost-Associated → Arthropoda → Ant Dump → Unclassified → Unclassified → Ant Dump → Characterization Of Biomass-Degrading Enzymes From Insect-Associated, Soil, And Chicken Feces Microbial Communities

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Soil (non-saline)

Location Information
LocationUSA: Wisconsin
CoordinatesLat. (o)43.0758Long. (o)-89.4125Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F069722Metagenome / Metatranscriptome123Y
F099558Metagenome / Metatranscriptome103Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0222423_1047961All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales898Open in IMG/M
Ga0222423_1083825All Organisms → cellular organisms → Bacteria591Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0222423_1047961Ga0222423_10479612F099558MSYSSQSDSLVPSITRRDRSIIGRLVSAVLSQWPERTRGSPPLDNYLRRDIGLEPIDHRSNYWDHQ
Ga0222423_1083825Ga0222423_10838252F069722RRRVGLSAELDPKAKRERPDLEKGAAHEKTLCHGSGAALQE

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.