Sample 3300024958

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Sample 3300024958

3300024958: Freshwater sediment methanotrophic microbial communities from Lake Washington under simulated oxygen tension - Sediment Metagenome 28_LOW6 (SPAdes)

Overview

Basic Information
IMG/M Taxon OID	3300024958 Open in IMG/M
GOLD Reference (Study \| Sequencing Project \| Analysis Project)	Gs0114290 \| Gp0111084 \| Ga0208263
Sample Name	Freshwater sediment methanotrophic microbial communities from Lake Washington under simulated oxygen tension - Sediment Metagenome 28_LOW6 (SPAdes)
Sequencing Status	Permanent Draft
Sequencing Center	DOE Joint Genome Institute (JGI)
Published?	N
Use Policy	Open

Dataset Contents
Total Genome Size	95132069
Sequencing Scaffolds	2
Novel Protein Genes	2
Associated Families	2

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → Viruses → Predicted Viral	1
Not Available	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
Name	Freshwater Sediment Methanotrophic Microbial Communities From Lake Washington Under Simulated Oxygen Tension
Type	Environmental
Taxonomy	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater → Freshwater Sediment Methanotrophic Microbial Communities From Lake Washington Under Simulated Oxygen Tension

Alternative Ecosystem Assignments
Environment Ontology (ENVO)	freshwater lake biome → freshwater lake → lake sediment
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Sediment (non-saline)

Location Information
Location	USA: Lake Washington, Seattle, Washington
Coordinates	Lat. (^o)	48.3807	Long. (^o)	-122.1599	Alt. (m)	N/A	Depth (m)	N/A
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F055534	Metagenome	138	Y
F100051	Metagenome / Metatranscriptome	103	Y

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
Ga0208263_108219	All Organisms → Viruses → Predicted Viral	2209	Open in IMG/M
Ga0208263_124684	Not Available	802	Open in IMG/M

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0208263_108219	Ga0208263_1082192	F055534	MRNLMNEEEREASHILDLIRYGGDVPASAITWALWVLGDLEAL
Ga0208263_124684	Ga0208263_1246842	F100051	MTQRTPTPVLIEAMFTRLLCAVVGHRYVVERVLNHGARKVGCTRCDKHWAMHDGTRAFLLWDEEFEELYAPGGVLAQSDRDLAK

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.