Sample 3300024965

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Sample 3300024965

3300024965: Freshwater sediment methanotrophic microbial communities from Lake Washington under simulated oxygen tension - Sediment Metagenome 115_HOW13 (SPAdes)

Overview

Basic Information
IMG/M Taxon OID	3300024965 Open in IMG/M
GOLD Reference (Study \| Sequencing Project \| Analysis Project)	Gs0114290 \| Gp0111141 \| Ga0208888
Sample Name	Freshwater sediment methanotrophic microbial communities from Lake Washington under simulated oxygen tension - Sediment Metagenome 115_HOW13 (SPAdes)
Sequencing Status	Permanent Draft
Sequencing Center	DOE Joint Genome Institute (JGI)
Published?	N
Use Policy	Open

Dataset Contents
Total Genome Size	107910626
Sequencing Scaffolds	1
Novel Protein Genes	2
Associated Families	2

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
Name	Freshwater Sediment Methanotrophic Microbial Communities From Lake Washington Under Simulated Oxygen Tension
Type	Environmental
Taxonomy	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment → Freshwater Sediment Methanotrophic Microbial Communities From Lake Washington Under Simulated Oxygen Tension

Alternative Ecosystem Assignments
Environment Ontology (ENVO)	freshwater lake biome → freshwater lake → lake sediment
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Sediment (non-saline)

Location Information
Location	USA: Lake Washington, Seattle, Washington
Coordinates	Lat. (^o)	48.3807	Long. (^o)	-122.1599	Alt. (m)	N/A	Depth (m)	N/A
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F034611	Metagenome / Metatranscriptome	174	Y
F105273	Metagenome	100	Y

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
Ga0208888_107792	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium	2106	Open in IMG/M

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0208888_107792	Ga0208888_1077925	F034611	MQQLNSILSLTTDLLAYGGFNHLKDDQVSNLHHLILRLKEPLTRVQENLLLTFWHNADAGILPPALVYRCNTVLQQRGLCPIGELYVEMEME
Ga0208888_134513	Ga0208888_1345132	F105273	MLVTAGFFSSGQSSTDSVYTGTLDSGKAKVVIDRETKGLNKAGLAKAIRTGTIYNSTSPYHNDLHEFTYWVAMRDFCNKALLKMRANGEVNKKRFKELK

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.