Sample 3300024976

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Sample 3300024976

3300024976: Freshwater sediment methanotrophic microbial communities from Lake Washington under simulated oxygen tension - Sediment Metagenome 16_LOW5 (SPAdes)

Overview

Basic Information
IMG/M Taxon OID	3300024976 Open in IMG/M
GOLD Reference (Study \| Sequencing Project \| Analysis Project)	Gs0114290 \| Gp0111076 \| Ga0208628
Sample Name	Freshwater sediment methanotrophic microbial communities from Lake Washington under simulated oxygen tension - Sediment Metagenome 16_LOW5 (SPAdes)
Sequencing Status	Permanent Draft
Sequencing Center	DOE Joint Genome Institute (JGI)
Published?	N
Use Policy	Open

Dataset Contents
Total Genome Size	128782272
Sequencing Scaffolds	1
Novel Protein Genes	1
Associated Families	1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
Not Available	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
Name	Freshwater Sediment Methanotrophic Microbial Communities From Lake Washington Under Simulated Oxygen Tension
Type	Environmental
Taxonomy	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment → Freshwater Sediment Methanotrophic Microbial Communities From Lake Washington Under Simulated Oxygen Tension

Alternative Ecosystem Assignments
Environment Ontology (ENVO)	freshwater lake biome → freshwater lake → lake sediment
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Sediment (non-saline)

Location Information
Location	USA: Lake Washington, Seattle, Washington
Coordinates	Lat. (^o)	48.3807	Long. (^o)	-122.1599	Alt. (m)	N/A	Depth (m)	N/A
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F055309	Metagenome	139	Y

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
Ga0208628_1040744	Not Available	638	Open in IMG/M

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0208628_1040744	Ga0208628_10407441	F055309	LGLNLANPVAKAHLRQIKSVVGPLSDFYLLQYGNNVRLPLTVNPLQTLTLPRNQRINLQTRGAPKAV

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.