NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300025063

3300025063: Hot spring microbial communities from Sandy's Spring West, USA to study Microbial Dark Matter (Phase II) - SSWsed_matched (SPAdes)



Overview

Basic Information
IMG/M Taxon OID3300025063 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)		Gs0111485 | Gp0127782 | Ga0209493
Sample NameHot spring microbial communities from Sandy's Spring West, USA to study Microbial Dark Matter (Phase II) - SSWsed_matched (SPAdes)
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size130607346
Sequencing Scaffolds6
Novel Protein Genes6
Associated Families2

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Archaea2
All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → unclassified Nitrososphaeria → Nitrososphaeria archaeon3
All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameBacterial And Archaeal Communities From Various Locations To Study Microbial Dark Matter (Phase Ii)
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Hot Spring → Bacterial And Archaeal Communities From Various Locations To Study Microbial Dark Matter (Phase Ii)

Alternative Ecosystem Assignments
Environment Ontology (ENVO)aquatic biome → hot spring → sediment
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Water (non-saline)

Location Information
LocationUSA: Nevada, Gerlach, Sandy's Spring West
CoordinatesLat. (o)40.653Long. (o)-119.3749Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F074155Metagenome120Y
F089858Metagenome108Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0209493_1009191All Organisms → cellular organisms → Archaea2461Open in IMG/M
Ga0209493_1019088All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → unclassified Nitrososphaeria → Nitrososphaeria archaeon1283Open in IMG/M
Ga0209493_1021981All Organisms → cellular organisms → Archaea1122Open in IMG/M
Ga0209493_1022043All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → unclassified Nitrososphaeria → Nitrososphaeria archaeon1119Open in IMG/M
Ga0209493_1034465All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon732Open in IMG/M
Ga0209493_1048841All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → unclassified Nitrososphaeria → Nitrososphaeria archaeon513Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0209493_1009191Ga0209493_10091915F089858EYVEREIRRKLSIPELEEEGLMEVIVSEVGVDGLLNIPVKQGELWVEELKDGRFALNLDDPDEPKITCAEVQLVHEGLEEETIKVRDVKYVILGDIPDMGRARLIRIRKGVREVEEAFNTND
Ga0209493_1019088Ga0209493_10190882F089858MEWVEYLVRLRFHVDGFYAEKLTREYVEREVRRKLSIPELEEEGLMEIIVSKKGFDGLLNIPVKRGELWVEELDDGRFTINLDDPDDPKITCVEVQVVREDLEEETIKAKDVKYVILGDIPDMGRARFVRIREGVREVEEE
Ga0209493_1021981Ga0209493_10219813F089858VDGFYAEKLTKEYVEREVRRKLSIPELEEEGLMEIIVSETGVDGLLNIPVKRGEIWIKELEDGRFAINLDGPDDPKITCVEVQAVHEDLEEETIKAKGVKYVIIGDIPDMGRARFVRIREGVREVEEGE
Ga0209493_1022043Ga0209493_10220433F089858MEWVEYLVRLRFHVDGFYPEKLTREYVEREVRRKLSVPELEEEGLMEIIISKKGFDGLLNIPVKRGELWVEELEDGRFAINLDDPDDPKITCAEVQVVHEDLEEETIKTKDVKYVIIGDIPGMGRARFVRIRKGVREIEEEGE
Ga0209493_1034465Ga0209493_10344651F074155EGSRFEGHWQPCNTLAFLKGLGDPALANSRGKALMRVLAKSPNGAADLGLRARQVKTLIEWEDPPQLRKVLSRISLLLTQMGQRENWLLANYAGNLARKIVAFKLLTKQPISHKLGDAIIAHTIEKFGLKTAASDLKVETEDLQLIRQLENMAQKPKRPKPAYQASSSINSN
Ga0209493_1048841Ga0209493_10488411F089858MEWVEYLVRLRFHVDGFYPERLTKEYVEREVRRKLSVPELEEEGLMEIIVSETGVDGLLNIPVKRGEIWIKELDDGRFAINLDDPDDPKITCAEVQAVHEDLEEETIKAKGVKHVIIGDIQDMGRARFVRIREGVREVEEE
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.