Sample 3300025067

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Sample 3300025067

3300025067: Hot spring microbial communities from Sandy's Spring West, USA to study Microbial Dark Matter (Phase II) - SSWsed_130316 (SPAdes)

Overview

Basic Information
IMG/M Taxon OID	3300025067 Open in IMG/M
GOLD Reference (Study \| Sequencing Project \| Analysis Project)	Gs0111485 \| Gp0127783 \| Ga0209393
Sample Name	Hot spring microbial communities from Sandy's Spring West, USA to study Microbial Dark Matter (Phase II) - SSWsed_130316 (SPAdes)
Sequencing Status	Permanent Draft
Sequencing Center	DOE Joint Genome Institute (JGI)
Published?	N
Use Policy	Open

Dataset Contents
Total Genome Size	137159849
Sequencing Scaffolds	2
Novel Protein Genes	2
Associated Families	2

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
Not Available	2

Ecosystem and Geography

Ecosystem Assignment (GOLD)
Name	Bacterial And Archaeal Communities From Various Locations To Study Microbial Dark Matter (Phase Ii)
Type	Environmental
Taxonomy	Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Hot Spring → Bacterial And Archaeal Communities From Various Locations To Study Microbial Dark Matter (Phase Ii)

Alternative Ecosystem Assignments
Environment Ontology (ENVO)	aquatic biome → hot spring → sediment
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Water (non-saline)

Location Information
Location	USA: Nevada, Gerlach, Sandy's Spring West
Coordinates	Lat. (^o)	40.653	Long. (^o)	-119.3749	Alt. (m)	N/A	Depth (m)	N/A
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F063403	Metagenome / Metatranscriptome	129	N
F084856	Metagenome / Metatranscriptome	112	N

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
Ga0209393_1018237	Not Available	1381	Open in IMG/M
Ga0209393_1020285	Not Available	1266	Open in IMG/M

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0209393_1018237	Ga0209393_10182372	F063403	MEGNINRTEALRELRAAIRSVRRTPIKIPFGNSDKFFIEIRIPKFSERLDIQMAAELFLGGFDSSERLVKALPPLITSFRLPAEDEEGNLMQAIYNAEPLPDLPVLQLEPSDLFSDESAFNATPVLMTLIITTLLTLSGRTQNVAAGMNELLELFPGTNQNATDLLDKGSSRVSGSE
Ga0209393_1020285	Ga0209393_10202852	F084856	SESGDAMSGTFNLTIVTHIYTSQHAEALKETLPEWVRLSPSQILVGYYQKKFQPSDFQCMETYDGVELVPVDSSSYGAAYDVLLERVVGKPILILAPYVIPKDWFVGSVSKWFESYAIIGHYKQPRILVADAILMPLIAPVVVELGRLQMDCIAVREDVPRSVGYHEWWFGSILVRARPGAFLLYNALAAGYPVLTLPYNCKPVRYVRNPERQPSKAHKK

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.