NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300025116

3300025116: Hot spring microbial communities from South Africa to study Microbial Dark Matter (Phase II) - Sagole hot spring metaG (SPAdes)



Overview

Basic Information
IMG/M Taxon OID3300025116 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)		Gs0111485 | Gp0138776 | Ga0209207
Sample NameHot spring microbial communities from South Africa to study Microbial Dark Matter (Phase II) - Sagole hot spring metaG (SPAdes)
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size354346899
Sequencing Scaffolds10
Novel Protein Genes11
Associated Families10

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria2
All Organisms → cellular organisms → Bacteria → Proteobacteria1
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea2
All Organisms → cellular organisms → Bacteria2
All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → unclassified Planctomycetia → Planctomycetia bacterium 21-64-51
Not Available1
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameBacterial And Archaeal Communities From Various Locations To Study Microbial Dark Matter (Phase Ii)
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring → Bacterial And Archaeal Communities From Various Locations To Study Microbial Dark Matter (Phase Ii)

Alternative Ecosystem Assignments
Environment Ontology (ENVO)aquatic biome → hot spring → spring water
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Water (non-saline)

Location Information
LocationSouth Africa: Limpopo
CoordinatesLat. (o)-22.5304Long. (o)30.6814Alt. (m)N/ADepth (m)1.5
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001564Metagenome / Metatranscriptome670Y
F010100Metagenome308Y
F018543Metagenome / Metatranscriptome234Y
F020532Metagenome / Metatranscriptome223Y
F024422Metagenome / Metatranscriptome206Y
F035198Metagenome / Metatranscriptome172Y
F042634Metagenome158Y
F051242Metagenome144Y
F053823Metagenome / Metatranscriptome140Y
F093898Metagenome / Metatranscriptome106Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0209207_1001459All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria10916Open in IMG/M
Ga0209207_1030831All Organisms → cellular organisms → Bacteria → Proteobacteria1305Open in IMG/M
Ga0209207_1034310All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea1212Open in IMG/M
Ga0209207_1036159All Organisms → cellular organisms → Bacteria1167Open in IMG/M
Ga0209207_1043195All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1028Open in IMG/M
Ga0209207_1054201All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea877Open in IMG/M
Ga0209207_1060877All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → unclassified Planctomycetia → Planctomycetia bacterium 21-64-5809Open in IMG/M
Ga0209207_1090352All Organisms → cellular organisms → Bacteria625Open in IMG/M
Ga0209207_1125842Not Available511Open in IMG/M
Ga0209207_1129022All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium504Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0209207_1001459Ga0209207_10014599F051242MKEDDPSKANDEKSLKLTVCKPEDQAFQRLHLCKYLSELYESAEEENKSSVEKKKA
Ga0209207_1030831Ga0209207_10308312F093898MMRFLLARAVNPSTTLLEGLRDWNKFAAALREPPRKRRRYQADSWDAFLS
Ga0209207_1031898Ga0209207_10318982F035198MKIFIEIKSIRYFLIKIILAMVVFLFLNYNSYIYYRVGLTINYGYVF
Ga0209207_1034310Ga0209207_10343103F035198SNKINYLFVLKIFIEIKTVRYFFIKVMLAVIVFLFLNYNRYIYYRVGLTINYGYVAVYAIRIVLLL
Ga0209207_1036159Ga0209207_10361593F001564MSGEWPERPSLRFLIHWALRRNELCDPGLCPDAPDDGGRCDHCPLDKLDAAQSSEMGVLLRRALDIRAALKLGVRIGLDEIRADEFQSLVVLEEERERLEQMRLADR
Ga0209207_1043195Ga0209207_10431952F010100VEQLVEEQPLQEELAVLLNLPPLEKAKADIIRLTFLLLHLGQVIFSEELNTSFSNSCSHCLQ
Ga0209207_1054201Ga0209207_10542011F053823MFTINPLDHNTKGTIDIIINSKSRIKKIIQKIKNRKETGNTLTLKESKPHSNPSDLIIFDLTNKLPTPITKG
Ga0209207_1060877Ga0209207_10608771F018543MSSRKEKMPNKGAAANRRPAGQADGAGNLLATVAADRAFPAAVAELCR
Ga0209207_1090352Ga0209207_10903522F042634MADALRAGYIEANEAGMEFLRYLPLSAMLRVLPWTAGGELFSFNCADLAEWPPALDRCFGRRVVNAYHIPVVPPRPGLGVFFNRCGARHNVVVSWIEGVVEPDDAARIIEVVRGEMGWTRTP
Ga0209207_1125842Ga0209207_11258422F020532MKQPASKRKKLDYPEETEGSRIAAKIRKLASKLTPEEEAEYIRRGMAKIYGGQPKEISGTGH
Ga0209207_1129022Ga0209207_11290221F024422MSLDYQKGAWPAWNLEPENGVPVPCALGQPWVNEDTQITLEKLRIPRTDPWGKPLPGEPEDPVLARLRRDPAD
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.