NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300025225

3300025225: Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes)



Overview

Basic Information
IMG/M Taxon OID3300025225 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)		Gs0053073 | Gp0101314 | Ga0209566
Sample NameArabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes)
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size102610665
Sequencing Scaffolds6
Novel Protein Genes6
Associated Families6

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Deinococcus-Thermus → Deinococci → Deinococcales → Deinococcaceae → Deinococcus → unclassified Deinococcus → Deinococcus sp. KSM4-111
Not Available4
All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Aquabacterium → unclassified Aquabacterium → Aquabacterium sp.1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameArabidopsis, Maize, Boechera And Miscanthus Rhizosphere Microbial Communities From Different Us Locations
TypeHost-Associated
TaxonomyHost-Associated → Plants → Roots → Endophytes → Unclassified → Arabidopsis Root → Arabidopsis, Maize, Boechera And Miscanthus Rhizosphere Microbial Communities From Different Us Locations

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Host-associated → Plant → Plant rhizosphere

Location Information
LocationUSA: North Carolina
CoordinatesLat. (o)35.6667Long. (o)-78.5097Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F034241Metagenome / Metatranscriptome175Y
F044564Metagenome / Metatranscriptome154Y
F045820Metagenome / Metatranscriptome152Y
F049748Metagenome / Metatranscriptome146Y
F056275Metagenome / Metatranscriptome137Y
F095729Metagenome105Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0209566_110654All Organisms → cellular organisms → Bacteria → Terrabacteria group → Deinococcus-Thermus → Deinococci → Deinococcales → Deinococcaceae → Deinococcus → unclassified Deinococcus → Deinococcus sp. KSM4-11922Open in IMG/M
Ga0209566_112037Not Available833Open in IMG/M
Ga0209566_112732Not Available798Open in IMG/M
Ga0209566_116041All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Aquabacterium → unclassified Aquabacterium → Aquabacterium sp.660Open in IMG/M
Ga0209566_119573Not Available554Open in IMG/M
Ga0209566_119965Not Available545Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0209566_110654Ga0209566_1106542F045820PDGRNGRVVGENDDNVLESIGKAVVAPVEGADEGAEPVDGQHGRAFVDLTKTLPQGQQAAPRTPTAPKPQGKAL
Ga0209566_112037Ga0209566_1120372F034241TRRAAPLFQRLRKAPMSQAKPRQYLGALRAALAAAKAVNKSRVAAYHVLPNGISCKMDWAGWSDPWYNATPRQQALLDVLQDLLDGGETEVPMIALKTALRLEIPESEILRSRDNVGADGESGYFFDDIMHGLYMLDAQETEQVFYGLIDRLMQPECGHAGLIDR
Ga0209566_112732Ga0209566_1127322F056275MDWHCIKFDRRGAHEAEAADLVLALEDAYGSAGEPAAAEVFMTHGRVGDYAFYLSPEAARMAPAVLQRFHAVLCEPPVDLHRCTPMIL
Ga0209566_116041Ga0209566_1160411F044564MTTQPDTTPRALRIDGPLSARAVLDHFNDKGRALLGAGQDDAAGRIAQLLAHEADLSAAWGGLPGTDHPRHWQPEVGDEAALSDRRSEHRRLDVHLPLWWALPLAVRDRQPQRVILPLAATREALAALIRRHMPGAWWNHTVHVTLDVETRV
Ga0209566_119573Ga0209566_1195731F049748EPEQTQSSVELDPTAGGDGAASEAAEHESLGGEMVQPTGGIGGTGGADGRLDPTKTGPGAVDGLVGAP
Ga0209566_119965Ga0209566_1199652F095729MPAADVAMPCNHSKETTVKIALRQIALVSTLLATAAFPLLSHAQDVRREDRVLHFLDSGHIDANKDGMVSKKEFMDAMSKTWDMHMSDAKKADPQMPKDKMT
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.