Sample 3300025284

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Sample 3300025284

3300025284: Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes)

Overview

Basic Information
IMG/M Taxon OID	3300025284 Open in IMG/M
GOLD Reference (Study \| Sequencing Project \| Analysis Project)	Gs0053073 \| Gp0061146 \| Ga0209130
Sample Name	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes)
Sequencing Status	Permanent Draft
Sequencing Center	DOE Joint Genome Institute (JGI)
Published?	N
Use Policy	Open

Dataset Contents
Total Genome Size	234172457
Sequencing Scaffolds	1
Novel Protein Genes	1
Associated Families	1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
Name	Arabidopsis, Maize, Boechera And Miscanthus Rhizosphere Microbial Communities From Different Us Locations
Type	Host-Associated
Taxonomy	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere → Arabidopsis, Maize, Boechera And Miscanthus Rhizosphere Microbial Communities From Different Us Locations

Alternative Ecosystem Assignments
Environment Ontology (ENVO)	Unclassified
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant rhizosphere

Location Information
Location	University of North Carolina, USA
Coordinates	Lat. (^o)	35.9082	Long. (^o)	-79.0499	Alt. (m)	N/A	Depth (m)	N/A
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F053537	Metagenome / Metatranscriptome	141	Y

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
Ga0209130_1062797	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae	639	Open in IMG/M

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0209130_1062797	Ga0209130_10627971	F053537	MKYMHKAIWQCDGNLVIRGNTRALLFRALEDARAGLAQREDAGELQRTLAALQQALGSYDGKLPSVVELLGDPVRDRISRNLLKG

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.