NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300026043

3300026043: Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_TuleB_D2 (SPAdes)



Overview

Basic Information
IMG/M Taxon OID3300026043 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)		Gs0111376 | Gp0116084 | Ga0208145
Sample NameNatural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_TuleB_D2 (SPAdes)
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size50455269
Sequencing Scaffolds3
Novel Protein Genes3
Associated Families3

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → Viruses → Varidnaviria → Bamfordvirae → Preplasmiviricota → Tectiliviricetes → Kalamavirales → Tectiviridae → Deltatectivirus1
Not Available1
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameNatural And Restored Wetland Microbial Communities From The San Francisco Bay, California, Usa, That Impact Long-Term Carbon Sequestration
TypeEnvironmental
TaxonomyEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands → Natural And Restored Wetland Microbial Communities From The San Francisco Bay, California, Usa, That Impact Long-Term Carbon Sequestration

Alternative Ecosystem Assignments
Environment Ontology (ENVO)terrestrial biome → wetland area → soil
Earth Microbiome Project Ontology (EMPO)Free-living → Saline → Water (saline)

Location Information
LocationUSA: Antioch, San Francisco Bay, California
CoordinatesLat. (o)38.052509Long. (o)-121.76873Alt. (m)N/ADepth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F024195Metagenome / Metatranscriptome207Y
F036673Metagenome169Y
F092001Metagenome / Metatranscriptome107Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0208145_1000030All Organisms → Viruses → Varidnaviria → Bamfordvirae → Preplasmiviricota → Tectiliviricetes → Kalamavirales → Tectiviridae → Deltatectivirus6109Open in IMG/M
Ga0208145_1000719Not Available2226Open in IMG/M
Ga0208145_1012752All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium590Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0208145_1000030Ga0208145_10000305F024195MNGDKLFNVLGAIVTVALVTTIVSRPTSAQVIKSMGDAFAGSIRAALGK
Ga0208145_1000719Ga0208145_10007192F036673LTPAPPAPLEVSDPQRAQTLKRKVLDRITDVRRHLNALQAAMAAFGEDFDLDVFQREFESEDPDELNRVKAVERGVDQLYNYMVELAAFGLELAGERRRFDETNARRDLDALARLGVISRERAARLQRLREYRRLFVHEYASATAAQVHEAARILADELPPFYRAYGEWVRTGFRVRR
Ga0208145_1012752Ga0208145_10127522F092001MIDTKSIPRPGERWLSCPPYLLIAHVLRVDERADPPVVSYELQDDEGLLLESVELALLDEGWWRTFQPMVRRSG
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.