NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300026362

3300026362: Sediment microbial communities from tidal freshwater marsh on Altamaha River, Georgia, United States - 10-16 C6



Overview

Basic Information
IMG/M Taxon OID3300026362 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)		Gs0133548 | Gp0296334 | Ga0256801
Sample NameSediment microbial communities from tidal freshwater marsh on Altamaha River, Georgia, United States - 10-16 C6
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size51612554
Sequencing Scaffolds12
Novel Protein Genes12
Associated Families12

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1
Not Available4
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfatibacillum → Desulfatibacillum alkenivorans1
All Organisms → cellular organisms → Bacteria3
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → unclassified Geobacteraceae → Geobacteraceae bacterium1
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1
All Organisms → cellular organisms → Archaea → Candidatus Thermoplasmatota → Thermoplasmata → unclassified Thermoplasmata → Thermoplasmata archaeon1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameSediment Microbial Communities From Tidal Freshwater Marsh On Altamaha River, Georgia, United States
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Sediment → Sediment Microbial Communities From Tidal Freshwater Marsh On Altamaha River, Georgia, United States

Alternative Ecosystem Assignments
Environment Ontology (ENVO)freshwater river biome → freshwater marsh → sediment
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Sediment (non-saline)

Location Information
LocationUSA: Georgia
CoordinatesLat. (o)31.3377Long. (o)-81.4644Alt. (m)N/ADepth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F003001Metagenome / Metatranscriptome514Y
F015418Metagenome / Metatranscriptome255Y
F019677Metagenome / Metatranscriptome228Y
F020200Metagenome225Y
F040709Metagenome / Metatranscriptome161Y
F056185Metagenome138Y
F056715Metagenome / Metatranscriptome137Y
F060457Metagenome / Metatranscriptome133Y
F063202Metagenome / Metatranscriptome130Y
F088761Metagenome / Metatranscriptome109Y
F088925Metagenome / Metatranscriptome109Y
F102135Metagenome / Metatranscriptome102Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0256801_1000299All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1197Open in IMG/M
Ga0256801_1000390Not Available1108Open in IMG/M
Ga0256801_1001085All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfatibacillum → Desulfatibacillum alkenivorans859Open in IMG/M
Ga0256801_1002022All Organisms → cellular organisms → Bacteria735Open in IMG/M
Ga0256801_1002286All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → unclassified Geobacteraceae → Geobacteraceae bacterium713Open in IMG/M
Ga0256801_1002718All Organisms → cellular organisms → Bacteria682Open in IMG/M
Ga0256801_1002817All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium676Open in IMG/M
Ga0256801_1004498Not Available598Open in IMG/M
Ga0256801_1004665Not Available592Open in IMG/M
Ga0256801_1005361All Organisms → cellular organisms → Bacteria570Open in IMG/M
Ga0256801_1005611Not Available563Open in IMG/M
Ga0256801_1008757All Organisms → cellular organisms → Archaea → Candidatus Thermoplasmatota → Thermoplasmata → unclassified Thermoplasmata → Thermoplasmata archaeon500Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0256801_1000299Ga0256801_10002993F060457MYKDNAEPHNSSSDLGIFLSTIFHIASIACVPFLANGTVNGNLYACGLLIVWTIYYSMRLAKSRKLLGLAFFVMILSAVVFGIYNFGLMSHYKNAKIYLEEEEIFCRETTYETLLSKYETEKSMISANFRICLDKAHVQPETCIKEVNHGTSLNEVMLSNRLLRLSNCANSLTTKQKSVDRLKHRPWVKFWLG
Ga0256801_1000390Ga0256801_10003904F003001MILTAIISVIASFVLVGAWTANLVSYHPATDLDPLTPISVDWK
Ga0256801_1001085Ga0256801_10010851F019677MITYSTPDVARILGIESSRVRDWIVKGFIIPSWHKAMARGDKNLLTYDNLCYVYLLQQLLSKGFHRTSIGFIISEIAKTGLSKNLESGFRYVIWNTKNPKEGGKVTISAEIPTSMIDILIIGDRRAVPRRYSQMLVIDLLEIKNEVNRKREKRGG
Ga0256801_1002022Ga0256801_10020221F063202NLRGYDIELGMDMTQVWEKLRSGFNVVEDEAGIFYISDKNDEPVGVIYFENEVAVKIIKDWGTTTKTNAGQVFKTLWNILKQYDKDLDSVKLIPIETFTSKGSKYSLQIYISKNRYLDITIQLAVTILEVLEEPKI
Ga0256801_1002286Ga0256801_10022862F020200MCWVCERLENLIAGWNEEREFQEKTSSDQYHRGLSKGYSECVKDLSEAVASMRLKGLCEKLPEYEGSINDKQRWDILNEILKLRDEDSNQE
Ga0256801_1002718Ga0256801_10027181F040709MLEIITIIVLVPIACIAWMIWTEQKSKQALDRDALDQAWREVPDDPNYAERRHFEERKRVVDQARADTAAN
Ga0256801_1002817Ga0256801_10028172F088925MQERKCSKCGSVNVYKNTSNNWHQDGVVLQMIAVDSFHDLFQTEAFLCLDCRNLEIQVAETSTMYGKQKVLVDTIKASNNWVKA
Ga0256801_1004498Ga0256801_10044981F056715MQEFRRVRVAIDSLIDEVKESIKRKSLSESMEQLEQARGLVQELRQMSTTDQAAIVAKRETTIAGLTDIAGKIKAPAIKKRSTKDRLEQVATL
Ga0256801_1004665Ga0256801_10046651F015418MSIVSRRTFTKGLLASALVSGNSAIGQPNDPGSIAIIDTPNNAAKVASKLSAQNVKVVVRFFARKAQLGLREKVMASDSNMIDG
Ga0256801_1005361Ga0256801_10053611F056185IRKVDLPREKELRANWKNYNTYCLRSRSGNVDFADAMLFQLKSDKTIQRDDDWREVTSDQMASGCASLLSDSSPVMQLLGENDEIFGYVIYNFNDQIWASIIDPKTIRLFYHVHPKGP
Ga0256801_1005611Ga0256801_10056111F088761KNYVINNGAFTASGNFSGYTALGDRIHLFKRQMQALGWESQTDVKFPFYCIATIKQIGQLDLKGNPVVDEKGLPVTSDRLTALSAFKTRDEIKQAHADASLLDIEIAQEIRTQASSAGLTEESLKALASSPF
Ga0256801_1008757Ga0256801_10087571F102135MFWIGFIVGIFLGANIGIVVAGLLISGKKNDAEDPKTQSPMDYAVMDEVKEVQGEMPALSKPVTYLDRYPHS
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.