NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300026440

3300026440: Metatranscriptome of enriched soil aggregate microbial communities from Iowa State University, Ames, United States - MC6-MC0932-MT (Metagenome Metatranscriptome)



Overview

Basic Information
IMG/M Taxon OID3300026440 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)		Gs0114432 | Gp0296230 | Ga0256781
Sample NameMetatranscriptome of enriched soil aggregate microbial communities from Iowa State University, Ames, United States - MC6-MC0932-MT (Metagenome Metatranscriptome)
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size155596099
Sequencing Scaffolds5
Novel Protein Genes5
Associated Families4

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
Not Available3
All Organisms → cellular organisms → Eukaryota1
All Organisms → cellular organisms → Bacteria → Proteobacteria1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameEnriched Soil Aggregate Microbial Communities From Iowa State University To Study Microbial Drivers Of Carbon Cycling
TypeEnvironmental
TaxonomyEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Enriched Soil Aggregate → Enriched Soil Aggregate Microbial Communities From Iowa State University To Study Microbial Drivers Of Carbon Cycling

Alternative Ecosystem Assignments
Environment Ontology (ENVO)terrestrial biome → research facility → soil
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Soil (non-saline)

Location Information
LocationUSA: Iowa
CoordinatesLat. (o)42.0Long. (o)-93.0Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F005470Metagenome / Metatranscriptome399Y
F036230Metagenome / Metatranscriptome170Y
F051903Metagenome / Metatranscriptome143Y
F071833Metagenome / Metatranscriptome121Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0256781_1040087Not Available901Open in IMG/M
Ga0256781_1046317Not Available821Open in IMG/M
Ga0256781_1047737All Organisms → cellular organisms → Eukaryota805Open in IMG/M
Ga0256781_1071117Not Available622Open in IMG/M
Ga0256781_1088714All Organisms → cellular organisms → Bacteria → Proteobacteria540Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0256781_1040087Ga0256781_10400871F071833MNFSSEFTQDPQQNINLVQILIKRKLIEPFEKLSRESVECYNLQKGTKEANNEYATRVNKCLDSWQKHFERVEDHTNKYLSNLRAKEALHFSKLFHCSNAINDKDIDACRKEENHRFATELKETFSQL
Ga0256781_1046317Ga0256781_10463171F051903GAMKRKGKKRTAEEKMCEQIAQVRRKPQRIGIGHILFLDETHKREGDVDSYSIFLPGEPPIIETSTTSPYAARYDMIACCSGHTVLPPIIYAPKERGKGVNQDMLLQFIRNLLAQAAGALDQYPLLLLLDKATIHSEAKILQEFHDWGCQELTEVLRIPTASAKRLSPLDNSLFNLWRQRVLASGALTKTNIKSRMSDAWNSFTSAELRAQYRHCGLLRHQNVYFDCPDPASHRHDS
Ga0256781_1047737Ga0256781_10477371F005470YQISISTNMSAINLRKEGQVITEFPPNLIKRSRLLTKLVEEFSSTEVDLEPAPGKDFSPATINKLKEFIVRFESGLPKLPKKPLLIFVTYNDWLDNNFPEDTREWLEEFFKPKSFYDLVELFNAAFYLQIDDLREICAARIAHSIILERKAPEDFLRDFGIVTSYQDFFTPEEEAKFIEKEFINKNDYEGVAAEDDEELNKE
Ga0256781_1071117Ga0256781_10711171F071833KNTSFLIMNFSSEFTQDPQQNINLVQILIKRKLIEPFEKLSKENVECYNLERGTLEGKPQYFERVNKCLDSWQRHFERVESNTNQYLSKLREKEASHFSKLFHCSNAINDPEIQACRKEENERFANELKDTFSQL
Ga0256781_1088714Ga0256781_10887142F036230MTQVNDIVQVKPGREVFGACLVVVTEVKSWGIQGYVQSAGVDGQQYIRLKSGDFEPTGGKAVWVAP
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.