NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300026650

3300026650: Grasslands soil microbial communities from Nunn, Colorado, USA, that are Nitrogen fertilized - NN1120 (SPAdes)



Overview

Basic Information
IMG/M Taxon OID3300026650 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)		Gs0053063 | Gp0055111 | Ga0208217
Sample NameGrasslands soil microbial communities from Nunn, Colorado, USA, that are Nitrogen fertilized - NN1120 (SPAdes)
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size3848355
Sequencing Scaffolds8
Novel Protein Genes8
Associated Families8

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1
Not Available5
All Organisms → cellular organisms → Bacteria1
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameSoil Microbial Communities From 10 Grassland Sites In Ca, Co, Ks, Ky, Mn, Mo, Nm, Sc, Tx, That Have Been Nitrogen Fertilized
TypeEnvironmental
TaxonomyEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil → Soil Microbial Communities From 10 Grassland Sites In Ca, Co, Ks, Ky, Mn, Mo, Nm, Sc, Tx, That Have Been Nitrogen Fertilized

Alternative Ecosystem Assignments
Environment Ontology (ENVO)grassland biome → land → fertilized soil
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Soil (non-saline)

Location Information
LocationNunn, Colorado, USA
CoordinatesLat. (o)40.81667Long. (o)-104.76667Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F007604Metagenome348Y
F010054Metagenome / Metatranscriptome309Y
F011886Metagenome / Metatranscriptome286Y
F013868Metagenome / Metatranscriptome267Y
F018075Metagenome / Metatranscriptome237N
F024739Metagenome / Metatranscriptome204N
F049469Metagenome / Metatranscriptome146N
F095253Metagenome105Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0208217_100095All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1101Open in IMG/M
Ga0208217_100301Not Available767Open in IMG/M
Ga0208217_100571All Organisms → cellular organisms → Bacteria617Open in IMG/M
Ga0208217_100587Not Available610Open in IMG/M
Ga0208217_100814Not Available550Open in IMG/M
Ga0208217_100845All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium544Open in IMG/M
Ga0208217_100974Not Available513Open in IMG/M
Ga0208217_100986Not Available510Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0208217_100095Ga0208217_1000952F095253EAGALRAALAACVVALLRAGTEAHLPHAETVAQRLVELC
Ga0208217_100301Ga0208217_1003012F024739PAGSFSAMWEYAIREYVQEWGEPTEDRSMGSFLEELNRLGEDGWEAVGITPRTHYDRGGGPGGWDSFTFVVLLKRLRPADDMMPRS
Ga0208217_100571Ga0208217_1005712F007604MMPTDPTRRSALSVALLAHADTRYEVDCWMAGNGQPNGSVRYDTDRAWFTIQGRPAAMRELADALVRCAELTE
Ga0208217_100587Ga0208217_1005871F010054MLIYGFVLWGLSLLGIRLPIELPRWLFLVLEAVVIWFLWKGVRAARRAPSNHVRLFSAQENWANAFTLQALILFLW
Ga0208217_100814Ga0208217_1008141F018075MSSKGRAVQGARTQSSSGKTGQKSFPLGRVCRQCGDPLSQYNPGPNCWNHTVEFPWRGPTARPKP
Ga0208217_100845Ga0208217_1008451F049469QLERVEAARRRFEQGVREVVQRLSGEFARVCQTAGAEGELRLLAGDRPEEYGVDVLVAHRAGERRRSYRDAAHSGGQRATIAILLLLATMGTAEAADLLIMDEHIAHLDSTNIDHVAALMHALADRVQFVLATPTNAESLRLSWCDLQLAFLPRDPGRAYSPPIRLLSRLGVGDLEARAP
Ga0208217_100974Ga0208217_1009741F013868MNGLSASELADLAGVTEAEVQRLADLGVLVARDGADPFLASDVQKVRLATACEQAGLPMEAIAAAVQQGRLSFAFLEAAPYRRWAVRS
Ga0208217_100986Ga0208217_1009861F011886PGLPARSRHRGVPLALAAGPLYGSGMELEVGPFDPALHIRSRDHYEAVRREAQLLSLGPEAAPARFEELIDRLSRQFPPSPVDEVADRAYLAREPSFAVRRDLPDELVPAALAACDELEELLDEFDRWANAEGVQLLEAPEDIKQYRKAYLDQVRAQLQKANG
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.