NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300026727

3300026727: Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G09A4-10 (SPAdes)



Overview

Basic Information
IMG/M Taxon OID3300026727 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)		Gs0095510 | Gp0072040 | Ga0207545
Sample NameSoil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G09A4-10 (SPAdes)
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size18987504
Sequencing Scaffolds7
Novel Protein Genes8
Associated Families8

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
Not Available3
All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → unclassified Nitrosopumilales → Nitrosopumilales archaeon1
All Organisms → cellular organisms → Bacteria → Proteobacteria1
All Organisms → cellular organisms → Archaea1
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga → unclassified Microvirga → Microvirga sp. VF161

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameSoil Microbial Communities From Arlington Agricultural Research Station In Wisconsin And Kellogg Biological Station In Michigan, Replicating The Bioenergy Cropping Systems Trials (Bcsts)
TypeEnvironmental
TaxonomyEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil → Soil Microbial Communities From Arlington Agricultural Research Station In Wisconsin And Kellogg Biological Station In Michigan, Replicating The Bioenergy Cropping Systems Trials (Bcsts)

Alternative Ecosystem Assignments
Environment Ontology (ENVO)terrestrial biome → agricultural field → agricultural soil
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Soil (non-saline)

Location Information
LocationWisconsin, United States
CoordinatesLat. (o)43.3Long. (o)-89.38Alt. (m)N/ADepth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002315Metagenome / Metatranscriptome572Y
F003758Metagenome / Metatranscriptome470Y
F023931Metagenome208Y
F026602Metagenome / Metatranscriptome197N
F063830Metagenome129Y
F082881Metagenome / Metatranscriptome113Y
F099265Metagenome / Metatranscriptome103N
F103530Metagenome101N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0207545_100344Not Available923Open in IMG/M
Ga0207545_100360All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → unclassified Nitrosopumilales → Nitrosopumilales archaeon911Open in IMG/M
Ga0207545_100626Not Available793Open in IMG/M
Ga0207545_100863All Organisms → cellular organisms → Bacteria → Proteobacteria725Open in IMG/M
Ga0207545_102114All Organisms → cellular organisms → Archaea574Open in IMG/M
Ga0207545_102618All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga → unclassified Microvirga → Microvirga sp. VF16543Open in IMG/M
Ga0207545_102887Not Available527Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0207545_100344Ga0207545_1003441F103530MPAPEDGKFERIDPPRYVAFRRVRGTSTLAVIASVEGRDRCGYQLGRWFSERTPHGVFRNVPVDADSYGIDESVAANLIDLIRNGQPLPPRIVRLMPEFPTN
Ga0207545_100360Ga0207545_1003602F099265MDKMNEDTILHFYRILENSLLESDISKINEEDIDAWSQSFKKVVRESREKSGKGVFVPFLMWKLGELSPVEASKYLVNRKQDECRVSYDHNNVEYILRVM
Ga0207545_100626Ga0207545_1006261F063830MRTALVTASVLGLALIGGTSARSDQSRSHADFQGYWMGVDPVDGGDARRSLILRSDGKYALAARDSMLTLCDSTDRGFASFDDGSVVSRTVMQSNSLIIECFNNGATVQLHLRFELVERGLMIETATLPDGSPVSTIVLHKVSTN
Ga0207545_100863Ga0207545_1008631F082881QFERGRSRALAPGQDPRPKYWEHYLEFYRVLTQGGTDGLPHQFTEMFQRAYTRAREELRNRRRGE
Ga0207545_102114Ga0207545_1021142F026602MEGINEEECNKIFNCKIISEDVLKYPDIVNPFTKNEDIAKTLVNNANDSKIMTEHTCQKLMDVDIVKKKDQKIGEQTPKYLVCLPXDTFALLT
Ga0207545_102456Ga0207545_1024561F023931AQTATRLRIYQVLFAISIIAGLLAGLWCIFDPVGFAQLVFQIDPYPQTWPRIWGATLFGLQLAYIPGVRNPSFYRWPNWASIAIKFLMTIIFLTAGSSFYLLAAWELVWFVILLVAYYRLMLAGIHGDP
Ga0207545_102618Ga0207545_1026182F002315MKRVAVLSMAMLTVAFAADKKTYRYNCKGGAFTVTAAVEASGRWSKAEPVVLQIDSEPPQTLIADPDVPDADSFTNKDYEFYALKTFITLTRKSHGVVVKTYNACWVE
Ga0207545_102887Ga0207545_1028872F003758PGTDVAIGKKAVKHISFDPRLSPNVLRAFENAEDEILMNTLKGAPRLDVPSLFRPQFMAEVQKEHPEYFADLPPLK
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.