NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300026738

3300026738: Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G08A5-10 (SPAdes)



Overview

Basic Information
IMG/M Taxon OID3300026738 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)		Gs0095510 | Gp0072044 | Ga0207524
Sample NameSoil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G08A5-10 (SPAdes)
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size21495309
Sequencing Scaffolds6
Novel Protein Genes6
Associated Families6

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria1
All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium2
Not Available2
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Hoeflea → unclassified Hoeflea → Hoeflea sp. WL00581

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameSoil Microbial Communities From Arlington Agricultural Research Station In Wisconsin And Kellogg Biological Station In Michigan, Replicating The Bioenergy Cropping Systems Trials (Bcsts)
TypeEnvironmental
TaxonomyEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil → Soil Microbial Communities From Arlington Agricultural Research Station In Wisconsin And Kellogg Biological Station In Michigan, Replicating The Bioenergy Cropping Systems Trials (Bcsts)

Alternative Ecosystem Assignments
Environment Ontology (ENVO)terrestrial biome → agricultural field → agricultural soil
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Soil (non-saline)

Location Information
LocationWisconsin, United States
CoordinatesLat. (o)43.3Long. (o)-89.38Alt. (m)N/ADepth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001033Metagenome / Metatranscriptome799Y
F002837Metagenome / Metatranscriptome527Y
F003463Metagenome / Metatranscriptome485Y
F013650Metagenome / Metatranscriptome269Y
F072466Metagenome121Y
F079256Metagenome / Metatranscriptome116N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0207524_100471All Organisms → cellular organisms → Bacteria847Open in IMG/M
Ga0207524_100638All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium787Open in IMG/M
Ga0207524_101597Not Available636Open in IMG/M
Ga0207524_102094Not Available595Open in IMG/M
Ga0207524_102518All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Hoeflea → unclassified Hoeflea → Hoeflea sp. WL0058566Open in IMG/M
Ga0207524_103922All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium506Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0207524_100471Ga0207524_1004711F003463SILIRELSLGGGMGTKEDNLRVGSEANIDIAAGGRHIRGQVLLRRARVNEVGFEIVNTDLESRYRLRRILMDSLERSAGTREGDWDGQRKPQPM
Ga0207524_100638Ga0207524_1006381F001033GHSLIARLTIAVFVFQMLGVTSVVHAERPDSTAGTSTAGTRKLFINPSSTSVALGKASLIVSPLTHRDGNYVGDYQLKVRPYFFKSEKGSLLLAASDDAVRKLQAGTAINFTGRAVTHKDGRTHIVLGRATPSSRDRGSVTFSIVTDDARIVFNTSYHFGT
Ga0207524_101597Ga0207524_1015971F072466VSGTIDFKPAFQAEKVTGRFIRTVVHIEEEVRDVGPLKNKQIIARRLVPKQEEFTDGYMIYFPQGHSMFVAADDTEQLQRIGVLSRPHMVDMNSGEIVPETYSLSPKEIVERKQHN
Ga0207524_102094Ga0207524_1020941F079256MRITMVLATAVVLGAIAAPLKAQDTAATKPGGLNKVAHNVSKTMKKAGRDTKAEVHRDASKTHQTLTKAGNDTKAQLKRTTGVTTHSPDANHKPGGVNKLARDVSHTSKTVGAKAKHSVKSASGEVHRDLTKAGKHAKE
Ga0207524_102518Ga0207524_1025181F013650LHKFSPEASTYNWGELMSTYFSEKAASSYYVGSRLLDQTIANNPKIADATMPFELPKKLTEAYYLSIQGFHILEKSNVEGAKKYVTFFLKHPDLISWYHAVPLHIVPASRQMLNSTKYQDHPVIQKRMDVLKFLDSVWTKGVPLYYWDGRELNPYIGLYHNENLAGWMLAMRNIKGMKSEQVVDEAAA
Ga0207524_103922Ga0207524_1039221F002837MPLEPCPTCGYALSTVDHHCRHCATSSRAIPSRPFDAKHLQQLIIMA
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.