NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300026798

3300026798: Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G05.2A3-12 (SPAdes)



Overview

Basic Information
IMG/M Taxon OID3300026798 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0095510 | Gp0091575 | Ga0207515
Sample NameSoil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G05.2A3-12 (SPAdes)
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size17679026
Sequencing Scaffolds5
Novel Protein Genes5
Associated Families5

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root14621
All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae1
All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameSoil Microbial Communities From Arlington Agricultural Research Station In Wisconsin And Kellogg Biological Station In Michigan, Replicating The Bioenergy Cropping Systems Trials (Bcsts)
TypeEnvironmental
TaxonomyEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil → Soil Microbial Communities From Arlington Agricultural Research Station In Wisconsin And Kellogg Biological Station In Michigan, Replicating The Bioenergy Cropping Systems Trials (Bcsts)

Alternative Ecosystem Assignments
Environment Ontology (ENVO)terrestrial biomeagricultural fieldagricultural soil
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Soil (non-saline)

Location Information
LocationWisconsin, United States
CoordinatesLat. (o)43.3Long. (o)-89.38Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F004992Metagenome / Metatranscriptome416Y
F026346Metagenome / Metatranscriptome198Y
F045732Metagenome / Metatranscriptome152N
F084203Metagenome / Metatranscriptome112N
F085515Metagenome111Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0207515_100137All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium859Open in IMG/M
Ga0207515_101206All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462574Open in IMG/M
Ga0207515_101403All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium554Open in IMG/M
Ga0207515_101480All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae548Open in IMG/M
Ga0207515_102077All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium510Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0207515_100137Ga0207515_1001373F045732CVCAGHVVCNMRHRRRRVFIDTQKGRVSAGFTVAAEADAADVSMRLRERGWIAYRLRLEAEQYAWIATVIDWARRAA
Ga0207515_101206Ga0207515_1012061F084203MRARIRRALWMFGALAFVAMPASAQESTEVAPLTTEDSALLANALVFDPGALATAPKKPLRLPGYRNNEYDITRTQKVDGSTTVVVKQPVQTEWSNSVGADLAPSKPTAYPLPLSTERNNGMPAGAAWASVGVPNLASVDARVDPTNEQGKV
Ga0207515_101403Ga0207515_1014032F004992MSNETPAAIDPDMFAAVFSENWDNARYIKSERISFMNAYSVICAGVLALLQSVQASDLIRIALLFFMTLFSLVGLLTSLRLKSELEECLAKIEAMTVQAKVSHFVALGQLEGRPSRYPRFRWIFPIFYTMTTAGFI
Ga0207515_101480Ga0207515_1014801F026346PPTEGGEAASRVASIVVETDKKGRCEERRFDNRTGKMVSANYVNCDARLEPERDTTPSENINRERIRAILGAFKK
Ga0207515_102077Ga0207515_1020771F085515QQLYRQSEARLEQANRTLGQAVFERLLLLDATLKSIPPNAVLQLAAAKRIPRVAPPVRRPRPKLGNQTQAGSLDGRVAMGGIIIDRTARLSAKRSRTDLIEASKALIAGLDLLARQRFAAVEFVGDDNKSIEVFGRLSRRPRLSARDSSDLRLGLPLVSVVHFGGGPRVY

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.