NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300027004

3300027004: Soil microbial communities from Kellog Biological Station, Michigan, USA - Nitrogen cycling UWRJ-G07K2-12 (SPAdes)



Overview

Basic Information
IMG/M Taxon OID3300027004 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)		Gs0095510 | Gp0072112 | Ga0207445
Sample NameSoil microbial communities from Kellog Biological Station, Michigan, USA - Nitrogen cycling UWRJ-G07K2-12 (SPAdes)
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size13984047
Sequencing Scaffolds4
Novel Protein Genes4
Associated Families4

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
Not Available2
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae2

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameSoil Microbial Communities From Arlington Agricultural Research Station In Wisconsin And Kellogg Biological Station In Michigan, Replicating The Bioenergy Cropping Systems Trials (Bcsts)
TypeEnvironmental
TaxonomyEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil → Soil Microbial Communities From Arlington Agricultural Research Station In Wisconsin And Kellogg Biological Station In Michigan, Replicating The Bioenergy Cropping Systems Trials (Bcsts)

Alternative Ecosystem Assignments
Environment Ontology (ENVO)terrestrial biome → agricultural field → agricultural soil
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Soil (non-saline)

Location Information
LocationUSA: Michigan
CoordinatesLat. (o)42.4Long. (o)-85.37Alt. (m)N/ADepth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F003758Metagenome / Metatranscriptome470Y
F011785Metagenome / Metatranscriptome287Y
F028161Metagenome / Metatranscriptome192N
F050525Metagenome / Metatranscriptome145N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0207445_100511Not Available695Open in IMG/M
Ga0207445_100856Not Available611Open in IMG/M
Ga0207445_101006All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae587Open in IMG/M
Ga0207445_101265All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae548Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0207445_100511Ga0207445_1005112F011785KSGFREQHRCASVVPKCRYLVAALILPRRQMMKILTTFTAVAALVAGISIAQAQGTMGQTGSGMQAPQATGTGAFCIATSPGGSLNCKYASLAACEKDAKPQNLNCSPNPKKSTTGSKQ
Ga0207445_100856Ga0207445_1008561F003758IGKKAVKHISFDPRMSPKVLRAFENAEDEVLTNTLKGAPRLNVPSLFRPQFMEAVQKEHPEYFADLPPLK
Ga0207445_101006Ga0207445_1010061F050525LAYLAGVSAIFGIGIVGLMALHSPTGRTPSSPPVAAAEPLAKPAKRPLDDKKTAHRNQTHKKVHVTRKQHEAPSIDAGRNAYGYAEELRRIDPNRFLFFGR
Ga0207445_101265Ga0207445_1012651F028161IQTAHAQDNKNIREDDYVRKVPLEDFKVPIVPIIPPGSSLDLRPGRTPDSADRVYNSTPFARDPTTPSIGLSIKSPFDDRK
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.