NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300027020

3300027020: Metatranscriptome of enriched soil aggregate microbial communities from Iowa State University, Ames, United States - MC6-MC0437-MT (Metagenome Metatranscriptome)



Overview

Basic Information
IMG/M Taxon OID3300027020 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0114432 | Gp0296255 | Ga0256879
Sample NameMetatranscriptome of enriched soil aggregate microbial communities from Iowa State University, Ames, United States - MC6-MC0437-MT (Metagenome Metatranscriptome)
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size140493560
Sequencing Scaffolds3
Novel Protein Genes3
Associated Families1

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Longamoebia → Centramoebida → Acanthamoebidae → Acanthamoeba → Acanthamoeba castellanii → Acanthamoeba castellanii str. Neff3

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameEnriched Soil Aggregate Microbial Communities From Iowa State University To Study Microbial Drivers Of Carbon Cycling
TypeEnvironmental
TaxonomyEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Enriched Soil Aggregate → Enriched Soil Aggregate Microbial Communities From Iowa State University To Study Microbial Drivers Of Carbon Cycling

Alternative Ecosystem Assignments
Environment Ontology (ENVO)terrestrial biomeresearch facilitysoil
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Soil (non-saline)

Location Information
LocationUSA: Iowa
CoordinatesLat. (o)42.0Long. (o)-93.0Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F098404Metagenome / Metatranscriptome103N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0256879_1058051All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Longamoebia → Centramoebida → Acanthamoebidae → Acanthamoeba → Acanthamoeba castellanii → Acanthamoeba castellanii str. Neff671Open in IMG/M
Ga0256879_1059545All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Longamoebia → Centramoebida → Acanthamoebidae → Acanthamoeba → Acanthamoeba castellanii → Acanthamoeba castellanii str. Neff659Open in IMG/M
Ga0256879_1064144All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Longamoebia → Centramoebida → Acanthamoebidae → Acanthamoeba → Acanthamoeba castellanii → Acanthamoeba castellanii str. Neff624Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0256879_1058051Ga0256879_10580511F098404CLSIFRLTHTVMRSFLVCVVLALAIACAAAQQTRPKLSETFESKGFVQIKHNGTLFFGEGWYHVSQPDGKALEAYAFGGAEHLNVYELQRFDKGKAFEIIHDVKKPICHTKPLTGKMPQLWDWVEKADYVRNFTANGSKFDLWGYKTAGITLEVAVPVGYPSILAYFGRFSAGNEFSYYIEQWKTDKPHSTWFEIPRECHLGSQ
Ga0256879_1059545Ga0256879_10595451F098404QIPAFSLDPQHIMRSALFFVVLAVAIACAAAAVRPKLSETFESNGFVSIKHNGTLFFGEGWYHVSQPDGKALEAYAFGGFDHLNVYELQRFDKGKAYEVIHDEKKPICHTKSLTGKMPQLWDWVEKADFVRNFTSAGTLYDLWSYKTAGITLEVGVPQAHPDILAYFGRFSAGNEFSYYVETWKNIKPHSTWFEIPRECHLGPK
Ga0256879_1064144Ga0256879_10641441F098404VLALAIACAAAQQTRPKLSETFESKGFVQIKHNGTLFFGEGWYHVSQPDGKALEAYAFGGAEHLNVYELQRFDKGKAFEVIHAGHDKTPICHTKSLTGKMPQLWDWVEKADYVRNFTANGSKFDLWGYKTAGITLEVAVPVGYPSILAYFGRFSAGNEFSYYIEQWKTDKPHSTWFEIPRECHLGSQ

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.