NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300027113

3300027113: Metatranscriptome of enriched soil aggregate microbial communities from Iowa State University, Ames, United States - MC6-MC0686-MT (Metagenome Metatranscriptome)



Overview

Basic Information
IMG/M Taxon OID3300027113 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)		Gs0114432 | Gp0296274 | Ga0256898
Sample NameMetatranscriptome of enriched soil aggregate microbial communities from Iowa State University, Ames, United States - MC6-MC0686-MT (Metagenome Metatranscriptome)
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size222716175
Sequencing Scaffolds3
Novel Protein Genes3
Associated Families3

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Eukaryota1
All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea1
All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Longamoebia → Centramoebida → Acanthamoebidae → Acanthamoeba → Acanthamoeba castellanii → Acanthamoeba castellanii str. Neff1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameEnriched Soil Aggregate Microbial Communities From Iowa State University To Study Microbial Drivers Of Carbon Cycling
TypeEnvironmental
TaxonomyEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Enriched Soil Aggregate → Enriched Soil Aggregate Microbial Communities From Iowa State University To Study Microbial Drivers Of Carbon Cycling

Alternative Ecosystem Assignments
Environment Ontology (ENVO)terrestrial biome → research facility → soil
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Soil (non-saline)

Location Information
LocationUSA: Iowa
CoordinatesLat. (o)42.0Long. (o)-93.0Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F005470Metagenome / Metatranscriptome399Y
F009305Metagenome / Metatranscriptome319Y
F098404Metagenome / Metatranscriptome103N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0256898_1065364All Organisms → cellular organisms → Eukaryota809Open in IMG/M
Ga0256898_1088034All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea661Open in IMG/M
Ga0256898_1091996All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Longamoebia → Centramoebida → Acanthamoebidae → Acanthamoeba → Acanthamoeba castellanii → Acanthamoeba castellanii str. Neff642Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0256898_1065364Ga0256898_10653641F005470YQISISANMSAINLRKEGQVITEFPPNLIKRSRLLTKLVEEFSSTEVDLEPAPGKDFSPATINKLKEFIVRFESGLPKLPKKPLLIFVTYNDWLDNNFPEDTREWLEEFFKPKSFYDLVELFNAAFYLQIDDLREICAARIAHSIILERKAPEDFLRDFGIVTSYQDFFTPEEEAKFIEKEFINKNDYEGVAAEDDEELNKE
Ga0256898_1088034Ga0256898_10880341F009305LIRLAYGHYVSAFYMAYLGLLHGIDMHYDXKNEATYDGLEPEMSWXDEALSNELGTFIEALIVLNIICWXLYPEPEALSYEIFMXGDIGLISDVRFYGVAPHXYFRPFMAWLIVCPHHKTGIFGLIFLFFSLFHQPTLHGVNESGFFYKRRLLFTINRVKQKNFYKQSHLNLEMNLFFQTTYALFIMCALYTNTFLPYGRFYNRLGGNIGMLSAYFYVF
Ga0256898_1091996Ga0256898_10919961F098404SIFRLTHTVMRSFLVCVVLALAIACAAAQQTRPKLSETFESKGFVQIKHNGTLFFGEGWFHVSQPDGKALEAYAFGGAEHLNVYELQRFDKGKAFEIIHDVKKPICHTKPLTGKMPQLWDWVEKADYVRNFTANGSKFDLWGYKTAGITLEVAVPVGYPSILAYFGRFSAGNEFSYYIEQWKTDKPHSTWFEIPRECHLGPKETC
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.