Sample 3300027276

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Sample 3300027276

3300027276: Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - LMS_cellobiose_enrichment (SPAdes)

Overview

Basic Information
IMG/M Taxon OID	3300027276 Open in IMG/M
GOLD Reference (Study \| Sequencing Project \| Analysis Project)	Gs0114675 \| Gp0119870 \| Ga0208297
Sample Name	Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - LMS_cellobiose_enrichment (SPAdes)
Sequencing Status	Permanent Draft
Sequencing Center	DOE Joint Genome Institute (JGI)
Published?	N
Use Policy	Open

Dataset Contents
Total Genome Size	288227685
Sequencing Scaffolds	1
Novel Protein Genes	1
Associated Families	1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
Not Available	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
Name	Deep Subsurface Shale Carbon Reservoir Microbial Communities From Ohio And West Virginia, Usa
Type	Environmental
Taxonomy	Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface → Deep Subsurface Shale Carbon Reservoir Microbial Communities From Ohio And West Virginia, Usa

Alternative Ecosystem Assignments
Environment Ontology (ENVO)	Unclassified
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Subsurface (non-saline)

Location Information
Location	USA: Ohio
Coordinates	Lat. (^o)	40.178	Long. (^o)	-81.073	Alt. (m)	N/A	Depth (m)	N/A
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F029444	Metagenome	188	Y

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
Ga0208297_1035462	Not Available	986	Open in IMG/M

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0208297_1035462	Ga0208297_10354623	F029444	MEVSEQLTGFEPEDLMPWTVSNLQRPFREDFSLEKSGIIAEKESQILGCRFVGFDEPKKAAPFFNF

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.