NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300027422

3300027422: Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G09A1-10 (SPAdes)



Overview

Basic Information
IMG/M Taxon OID3300027422 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)		Gs0095510 | Gp0072025 | Ga0207611
Sample NameSoil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G09A1-10 (SPAdes)
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size14561124
Sequencing Scaffolds8
Novel Protein Genes8
Associated Families8

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria2
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1
Not Available2
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC68601
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameSoil Microbial Communities From Arlington Agricultural Research Station In Wisconsin And Kellogg Biological Station In Michigan, Replicating The Bioenergy Cropping Systems Trials (Bcsts)
TypeEnvironmental
TaxonomyEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil → Soil Microbial Communities From Arlington Agricultural Research Station In Wisconsin And Kellogg Biological Station In Michigan, Replicating The Bioenergy Cropping Systems Trials (Bcsts)

Alternative Ecosystem Assignments
Environment Ontology (ENVO)terrestrial biome → agricultural field → agricultural soil
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Soil (non-saline)

Location Information
LocationWisconsin, United States
CoordinatesLat. (o)43.3Long. (o)-89.38Alt. (m)N/ADepth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001436Metagenome / Metatranscriptome695Y
F005189Metagenome / Metatranscriptome409Y
F017145Metagenome / Metatranscriptome242Y
F021340Metagenome219Y
F026346Metagenome / Metatranscriptome198Y
F033457Metagenome / Metatranscriptome177Y
F060880Metagenome / Metatranscriptome132N
F071512Metagenome / Metatranscriptome122Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0207611_100135All Organisms → cellular organisms → Bacteria926Open in IMG/M
Ga0207611_100178All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales876Open in IMG/M
Ga0207611_100452Not Available719Open in IMG/M
Ga0207611_100480All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860707Open in IMG/M
Ga0207611_100865All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria613Open in IMG/M
Ga0207611_100977All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae595Open in IMG/M
Ga0207611_101156Not Available570Open in IMG/M
Ga0207611_101341All Organisms → cellular organisms → Bacteria550Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0207611_100135Ga0207611_1001351F071512RRLMTVSLGLLGRIDEATESLANTLALQPDFSTDHVAYNTVFAHASDRSRFLRGLQKAGLRN
Ga0207611_100178Ga0207611_1001782F021340MRHSKLQTFQAHRTIARANVARSQFWHVAIVTLFFVIVLGASLFLGTVMVIGTFHGVDPSNELTANGRAGRIARTLRDGTLCHYMIFDNKTAQTVEDRIGRCDENKAKPKQERPATFTWG
Ga0207611_100452Ga0207611_1004522F017145MAARKSSHRHWMLRDIPRTYVLLTWLAFGAALLIYSNDWHPSGWTALRKEATAPKPPVSVTEQYTGSIIIVPTRGEDCRQMMLDNRTGRMWDKGVVNCYEAVSRSEKEQRGGMSSLRINAIGKAFNRRDE
Ga0207611_100480Ga0207611_1004802F060880MHTSADFRKTQRRRAELRSRSEAAVATIWLVFYVLGLVVAVSSPIVSRAIEFAA
Ga0207611_100865Ga0207611_1008651F005189FAQDVDPRCKDIFDKVACTCAVRNGGHVIPPPVGIKREGLKLRPKEEAGGTQTLDGGRVAFPKYYRREGLKFHRSRALEGYLACMRAAGRK
Ga0207611_100977Ga0207611_1009771F026346EGGEAASRVASIVVETDKKGRCEERRFDNRTGKMVSANYVNCDARLEPERDSTPSENINRERIRAILGAFKK
Ga0207611_101156Ga0207611_1011562F033457MRNFMSYVLASAFVVLLLAVVTPPGFGVAARPSIEGQRLAPQIVDRTRKSDQLPVPKATGRRLTPPAAPVLVGCDPVFSALSKDKQANYPGRCL
Ga0207611_101341Ga0207611_1013411F001436IELLKLAAEQWPHANCEISQTDLFHRNQSLLEMWPEACRRAGVGGRDFPSGVIKLWKQGAGRVN
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.