Basic Information | |
---|---|
IMG/M Taxon OID | 3300027449 Open in IMG/M |
GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0095510 | Gp0072125 | Ga0207531 |
Sample Name | Soil microbial communities from Kellog Biological Station, Michigan, USA - Nitrogen cycling UWRJ-G10K5-12 (SPAdes) |
Sequencing Status | Permanent Draft |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Published? | N |
Use Policy | Open |
Dataset Contents | |
---|---|
Total Genome Size | 3885450 |
Sequencing Scaffolds | 3 |
Novel Protein Genes | 3 |
Associated Families | 3 |
Dataset Phylogeny | |
---|---|
Taxonomy Groups | Number of Scaffolds |
All Organisms → cellular organisms → Bacteria | 1 |
Not Available | 2 |
Ecosystem Assignment (GOLD) | |
---|---|
Name | Soil Microbial Communities From Arlington Agricultural Research Station In Wisconsin And Kellogg Biological Station In Michigan, Replicating The Bioenergy Cropping Systems Trials (Bcsts) |
Type | Environmental |
Taxonomy | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil → Soil Microbial Communities From Arlington Agricultural Research Station In Wisconsin And Kellogg Biological Station In Michigan, Replicating The Bioenergy Cropping Systems Trials (Bcsts) |
Alternative Ecosystem Assignments | |
---|---|
Environment Ontology (ENVO) | terrestrial biome → agricultural field → agricultural soil |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) |
Location Information | ||||||||
---|---|---|---|---|---|---|---|---|
Location | USA: Michigan | |||||||
Coordinates | Lat. (o) | 42.4 | Long. (o) | -85.37 | Alt. (m) | N/A | Depth (m) | 0 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F001436 | Metagenome / Metatranscriptome | 695 | Y |
F017236 | Metagenome / Metatranscriptome | 242 | Y |
F058266 | Metagenome | 135 | N |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
Ga0207531_100287 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
Ga0207531_100402 | Not Available | 590 | Open in IMG/M |
Ga0207531_100709 | Not Available | 504 | Open in IMG/M |
Scaffold ID | Protein ID | Family | Sequence |
---|---|---|---|
Ga0207531_100287 | Ga0207531_1002871 | F001436 | ELLKLAAEQWPHANCEISQTDLFHRNQSLLEMWPEACRRAGVGGRDFPSGVIKLWKQGAGRVN |
Ga0207531_100402 | Ga0207531_1004022 | F058266 | MNNDRLLVVFVVLYLIVIVALLFKDAPRPVAPEVKTPVAKVETAPIAKEDKPDAARPQADDGGKPGATPNCEKELRRTADLLRFFANRIQGGEDAQSVVADMRQQ |
Ga0207531_100709 | Ga0207531_1007091 | F017236 | MQHLPKQAVFLGRGLQARFDCCYQPLPDELNVLLWFLDGAERRGHIQATLNARQRVKLDLPADVHWMPADQVPEARADWRGHERHFESLRRAIDFVMQELTIADRANVTITTEDGNLTIE |
⦗Top⦘ |