NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300028179

3300028179: Metatranscriptome of enriched soil aggregate microbial communities from Iowa State University, Ames, United States - MC6-MC0741-MT (Metagenome Metatranscriptome)



Overview

Basic Information
IMG/M Taxon OID3300028179 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)		Gs0114432 | Gp0296279 | Ga0256903
Sample NameMetatranscriptome of enriched soil aggregate microbial communities from Iowa State University, Ames, United States - MC6-MC0741-MT (Metagenome Metatranscriptome)
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size215335858
Sequencing Scaffolds3
Novel Protein Genes3
Associated Families3

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora1
All Organisms → cellular organisms → Eukaryota1
All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Longamoebia → Centramoebida → Acanthamoebidae → Acanthamoeba → Acanthamoeba castellanii → Acanthamoeba castellanii str. Neff1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameEnriched Soil Aggregate Microbial Communities From Iowa State University To Study Microbial Drivers Of Carbon Cycling
TypeEnvironmental
TaxonomyEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Enriched Soil Aggregate → Enriched Soil Aggregate Microbial Communities From Iowa State University To Study Microbial Drivers Of Carbon Cycling

Alternative Ecosystem Assignments
Environment Ontology (ENVO)terrestrial biome → research facility → soil
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Soil (non-saline)

Location Information
LocationUSA: Iowa
CoordinatesLat. (o)42.0Long. (o)-93.0Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F075510Metagenome / Metatranscriptome118N
F098404Metagenome / Metatranscriptome103N
F104141Metagenome / Metatranscriptome100Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0256903_1000231All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora18055Open in IMG/M
Ga0256903_1042110All Organisms → cellular organisms → Eukaryota1137Open in IMG/M
Ga0256903_1100587All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Longamoebia → Centramoebida → Acanthamoebidae → Acanthamoeba → Acanthamoeba castellanii → Acanthamoeba castellanii str. Neff632Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0256903_1000231Ga0256903_100023114F075510FFLFHGKVYWXIFTDKNLNTDTLIRLAYGHYVSAFYMAYLGLLHGIDMHYDXKNEATYDGLEPEMSXXDEALSNELGTFIEALIVLNIICWXLYPEPEALSYEIFMXGDIGLISDVRFYGVAPHXYFRPFMAXLIVCPHHKTGIFGLIFLFFSLFHQPTLHGVNENGFFYKRRLLFTINRVKQKNFYKQSHLNLEMNLFFQTTYALFIMCALYTNTFLPYGRFYNRLGGNIGMLSAYFYVFLYLGITSLRRPYXLELYFYFIYNRTNFLKKNLVFLPKINFYK
Ga0256903_1042110Ga0256903_10421101F104141MQSLNILPSLLQQGHQEIDGHVDVLSEFFFSHGGDTDGGTHTEDLLQLESDGGFNFLELFFDLFVFTDSDGELADLVEGVTHKLGDLLHQGFGGEEDIERLSPLLDQFLILVELLGTIDIDATNIDLLGLVAMDGSTDKTDLSVGGGDVGESDRSVESLILFGIVVSQTNLEFNGFGELSLLSASQHVGDGLLKGFGTDLARGKGKRRRTRKEVFYLMVLISN
Ga0256903_1100587Ga0256903_11005871F098404VMRSFLVCVVLALAIACAAAQQTRPKLSETFESKGFVQIKHNGTLFFGEGWFHVSQPDGKALEAYAFGGAEHLNVYELQRFDKGKAFEIIHDVKKPICHTKPLTGKMPQLWDWVEKADYVRNFTANGSKFDLWGYKTAGITLEVAVPVGYPSILAYFGRFSAGNEFSYYVEQWKTDKPHSTWFEIPRECHLGSQ
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.