NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300028180

3300028180: Metatranscriptome of enriched soil aggregate microbial communities from Iowa State University, Ames, United States - MC6-MC0742-MT (Metagenome Metatranscriptome)



Overview

Basic Information
IMG/M Taxon OID3300028180 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)		Gs0114432 | Gp0296280 | Ga0256904
Sample NameMetatranscriptome of enriched soil aggregate microbial communities from Iowa State University, Ames, United States - MC6-MC0742-MT (Metagenome Metatranscriptome)
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size204496456
Sequencing Scaffolds4
Novel Protein Genes4
Associated Families4

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Eukaryota2
Not Available2

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameEnriched Soil Aggregate Microbial Communities From Iowa State University To Study Microbial Drivers Of Carbon Cycling
TypeEnvironmental
TaxonomyEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Enriched Soil Aggregate → Enriched Soil Aggregate Microbial Communities From Iowa State University To Study Microbial Drivers Of Carbon Cycling

Alternative Ecosystem Assignments
Environment Ontology (ENVO)terrestrial biome → research facility → soil
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Soil (non-saline)

Location Information
LocationUSA: Iowa
CoordinatesLat. (o)42.0Long. (o)-93.0Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F003289Metagenome / Metatranscriptome495Y
F071833Metagenome / Metatranscriptome121Y
F080697Metagenome / Metatranscriptome114Y
F104141Metagenome / Metatranscriptome100Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0256904_1047575All Organisms → cellular organisms → Eukaryota935Open in IMG/M
Ga0256904_1058141Not Available822Open in IMG/M
Ga0256904_1061244All Organisms → cellular organisms → Eukaryota796Open in IMG/M
Ga0256904_1089779Not Available622Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0256904_1047575Ga0256904_10475751F080697VQLLLLAGLDLGLFLTSDLLSLGLKFLSGLSVVDLGFEDFHSSKSVFRFVLEEIIVVVIDQNETSSSATTEMSVEAESDDVLDISLELLGDEFSNSLVGDISLAGMEDFQDHLLSGEKSV
Ga0256904_1058141Ga0256904_10581411F003289MXGNIVTEVALQTNFGVGFNNTQSDVLIHLTQXQYWWXFXFSFLXAFYYLVILRIIRFRTLKFRPRLATTYRPHGKXGDLIICLIPISWCVNIITNSSFILKMIEXQAETGLLTIRIRGKQXYXIYKFELKTFTDILTVPKNVGRNKXQISTPGDLQVADDYLHILQLRSQNKXVKKYXNDLSQKFYRNKNFHLISPQEQLKFNFYQNLTNYEFLKNSKKLKIDNFLNLNVSDKNNFLVLNKNYNNILVRTNNK
Ga0256904_1061244Ga0256904_10612441F104141MQSLNILPSLLQQGHQEIDGHVDVLSEFFFSHGGDTDGGTHTEDLLQLESDGGFNFLELFFDLFVFTDSDGELADLVKGVTHKLGDLLHQGFGGEEDIERLSPLLDQFLILVELLGTIDIDATNIDLLGLVTVDGSTDKTDLSVGGGDIGESDGSVESLILFGVVVSQTDLEFNSFGELSGLSTGKHIS
Ga0256904_1089779Ga0256904_10897791F071833KQSNQKTMNLSSDYTQDPQQNINLVQILIKRKLIEPFEKLSKENVECYNLERGTLEGKPQYFERVNKCLDSWQRHFERVESNTNQYLSKLREKEASHFSKLFHCSNAIDDPEIQACRKEENERFANELKDTFSQL
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.