NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300028185

3300028185: Metatranscriptome of enriched soil aggregate microbial communities from Iowa State University, Ames, United States - MC6-MC0669-MT (Metagenome Metatranscriptome)



Overview

Basic Information
IMG/M Taxon OID3300028185 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0114432 | Gp0296272 | Ga0256896
Sample NameMetatranscriptome of enriched soil aggregate microbial communities from Iowa State University, Ames, United States - MC6-MC0669-MT (Metagenome Metatranscriptome)
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size253039543
Sequencing Scaffolds3
Novel Protein Genes3
Associated Families3

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Eukaryota2
Not Available1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameEnriched Soil Aggregate Microbial Communities From Iowa State University To Study Microbial Drivers Of Carbon Cycling
TypeEnvironmental
TaxonomyEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Enriched Soil Aggregate → Enriched Soil Aggregate Microbial Communities From Iowa State University To Study Microbial Drivers Of Carbon Cycling

Alternative Ecosystem Assignments
Environment Ontology (ENVO)terrestrial biomeresearch facilitysoil
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Soil (non-saline)

Location Information
LocationUSA: Iowa
CoordinatesLat. (o)42.0Long. (o)-93.0Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F006377Metagenome / Metatranscriptome374Y
F071833Metagenome / Metatranscriptome121Y
F104141Metagenome / Metatranscriptome100Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0256896_1079365All Organisms → cellular organisms → Eukaryota833Open in IMG/M
Ga0256896_1126617All Organisms → cellular organisms → Eukaryota603Open in IMG/M
Ga0256896_1139482Not Available563Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0256896_1079365Ga0256896_10793651F104141MQSLNILPSLLQQGHQEIDGHVDVLSEFFFSHGGDTDGGTHTEDLLQLESDGGFNFLELFFDLFVFTDSDGELADLVKGVTHKLGDLLHQGFGGEEDIERLSPLLDQFLILVELLGTIDIDATNIDLLGLVAMDGSTDKTDLSVGGGDVGESDRAVESLILFGVVVSQTNLEFNGFGELSLLSASQHVGDGLLKGFGTDLAHGANL
Ga0256896_1126617Ga0256896_11266171F006377VGVLLKGGVSRTLGSTDTGLTMGSGLVGKTEFTEVSADHIELDFDIGEFFTSVDTDNGSDHFGEDDGVSEVSLDGSGLFTGLDTDLGLSELLDKSGVFMLKTSVESSSDSGS
Ga0256896_1139482Ga0256896_11394821F071833KTMNLSSDYTQDPQQNINLVQILIKRKLIEPFEKLSKENVECYNLERGTLEGKPQYFERVNKCLDSWQRHFERVESNTNQYLSKLREKEASHFSKLFHCSNAIDDPEIQACRKEENERFANELKDTFSQL

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.