NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300028270

3300028270: Metatranscriptome of enriched soil aggregate microbial communities from Iowa State University, Ames, United States - MC6-MC0944-MT (Metagenome Metatranscriptome)



Overview

Basic Information
IMG/M Taxon OID3300028270 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)		Gs0114432 | Gp0296242 | Ga0256793
Sample NameMetatranscriptome of enriched soil aggregate microbial communities from Iowa State University, Ames, United States - MC6-MC0944-MT (Metagenome Metatranscriptome)
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size248203853
Sequencing Scaffolds4
Novel Protein Genes4
Associated Families3

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Eukaryota3
Not Available1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameEnriched Soil Aggregate Microbial Communities From Iowa State University To Study Microbial Drivers Of Carbon Cycling
TypeEnvironmental
TaxonomyEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Enriched Soil Aggregate → Enriched Soil Aggregate Microbial Communities From Iowa State University To Study Microbial Drivers Of Carbon Cycling

Alternative Ecosystem Assignments
Environment Ontology (ENVO)terrestrial biome → research facility → soil
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Soil (non-saline)

Location Information
LocationUSA: Iowa
CoordinatesLat. (o)42.0Long. (o)-93.0Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F005470Metagenome / Metatranscriptome399Y
F071833Metagenome / Metatranscriptome121Y
F096377Metagenome / Metatranscriptome104Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0256793_1077634All Organisms → cellular organisms → Eukaryota830Open in IMG/M
Ga0256793_1110594Not Available656Open in IMG/M
Ga0256793_1152711All Organisms → cellular organisms → Eukaryota524Open in IMG/M
Ga0256793_1155587All Organisms → cellular organisms → Eukaryota517Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0256793_1077634Ga0256793_10776341F005470QESPSQQGRRKVHRRSEVITAAFCSLPTSNMSVKVRKEGQVITEFPKEMVPRSRLLTKLVEEFSSTEVDLEPAPGKDFSPATINKVREFLAKFEKGLHKMPKKPLLIFVTYNDWLDNNFDENTREWLEEFLKPKSFYELVELFNAAFYLQIDDLREISAARIAHSIILERKAPEDFLRDFGIATQYQDFFTPEEEAKFIEKEFINKNDYEGVAAEDDEELNKE
Ga0256793_1110594Ga0256793_11105941F071833YFDSINIKQSNQKTMNLSSDYTQDPQQNINLVQILIKRKLIEPFEKLSKENVECYNLERGTLEGKPQYFERVNKCLDSWQRHFERVESNTNQYLSKLREKEASHFSKLFHCSNAIDDPEIQACRKEENERFANELKDTFSQL
Ga0256793_1152711Ga0256793_11527111F096377KINNNSDLVQFQSKYKSTPLYFIPTDDNNVNIFITDNDAIINDILGQEDIIEDVVSKLFAKLDRNPTPFQEDLWLPIFSIKEKTIDLEAAKTLLKDEYKVNYATNTCTIGLNGSRVPGNLKVRPNEKSKIIEKPFLFGILHEQVDFPLFAVVVKPEDFAQHE
Ga0256793_1155587Ga0256793_11555871F005470NYCSLPTSNMSVKVRKEGQVITEFPKEMVPRSRLLTKLVEEFSSTEVDLEPAPGKDFSPATINKVREFLAKFEKGLHKMPKKPLLIFVTYNDWLDNNFDENTREWLEEFLKPKSFYELVELFNAAFYLQIDDLREISAARIAHSIILERKAPEDFLRDFGIATQYQDFFTPE
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.