NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300028278

3300028278: Metatranscriptome of enriched soil aggregate microbial communities from Iowa State University, Ames, United States - MC6-MC0687-MT (Metagenome Metatranscriptome)



Overview

Basic Information
IMG/M Taxon OID3300028278 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0114432 | Gp0296275 | Ga0256899
Sample NameMetatranscriptome of enriched soil aggregate microbial communities from Iowa State University, Ames, United States - MC6-MC0687-MT (Metagenome Metatranscriptome)
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size217002079
Sequencing Scaffolds7
Novel Protein Genes7
Associated Families7

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Comamonas1
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Hypocreomycetidae → Hypocreales → Cordycipitaceae → Beauveria → Beauveria bassiana → Beauveria bassiana D1-51
All Organisms → cellular organisms → Eukaryota3
All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Longamoebia → Centramoebida → Acanthamoebidae → Acanthamoeba → Acanthamoeba castellanii → Acanthamoeba castellanii str. Neff1
Not Available1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameEnriched Soil Aggregate Microbial Communities From Iowa State University To Study Microbial Drivers Of Carbon Cycling
TypeEnvironmental
TaxonomyEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Enriched Soil Aggregate → Enriched Soil Aggregate Microbial Communities From Iowa State University To Study Microbial Drivers Of Carbon Cycling

Alternative Ecosystem Assignments
Environment Ontology (ENVO)terrestrial biomeresearch facilitysoil
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Soil (non-saline)

Location Information
LocationUSA: Iowa
CoordinatesLat. (o)42.0Long. (o)-93.0Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F005470Metagenome / Metatranscriptome399Y
F036230Metagenome / Metatranscriptome170Y
F054554Metagenome / Metatranscriptome139Y
F057456Metagenome / Metatranscriptome136N
F080697Metagenome / Metatranscriptome114Y
F096377Metagenome / Metatranscriptome104Y
F098404Metagenome / Metatranscriptome103N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0256899_1046547All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Comamonas992Open in IMG/M
Ga0256899_1058896All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Hypocreomycetidae → Hypocreales → Cordycipitaceae → Beauveria → Beauveria bassiana → Beauveria bassiana D1-5860Open in IMG/M
Ga0256899_1075092All Organisms → cellular organisms → Eukaryota740Open in IMG/M
Ga0256899_1096032All Organisms → cellular organisms → Eukaryota632Open in IMG/M
Ga0256899_1096058All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Longamoebia → Centramoebida → Acanthamoebidae → Acanthamoeba → Acanthamoeba castellanii → Acanthamoeba castellanii str. Neff632Open in IMG/M
Ga0256899_1117648All Organisms → cellular organisms → Eukaryota554Open in IMG/M
Ga0256899_1135088Not Available506Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0256899_1046547Ga0256899_10465473F036230CEGTMTQVNDIVQVKPGREVFGACLVVVTEVKSWGIQGYVQSAGVDGQQYIRLKSGDFEPTGGKAVWVAP
Ga0256899_1058896Ga0256899_10588961F057456AFPIIQDLSLLHLVILCPAYATVRFVDNQTVRQDLAVELFR
Ga0256899_1075092Ga0256899_10750921F005470ISTNMSAINLRKEGQVITEFPPNLIKRSRLLTKLVEEFSSTEVDLEPAPGKDFSPATINKLKEFIVRFESGLPKLPKKPLLIFVTYNDWLDNNFPEDTREWLEEFFKPKSFYDLVELFNAAFYLQIDDLREICAARIAHSIILERKAPEDFLRDFGIVTSYQDFFTPEEEAKFIEKEFINKNDYEGVAAEDDEELNKE
Ga0256899_1096032Ga0256899_10960322F080697AGLDLGLFLTSDLLSLGLKFLSGLSVVDLGFEDFHSSKSVFGFVLEEIIVVVIDQNETSSSATTEMSVEAESDDVLDISLELLGDEFSNSLVGDISLAGMEDFQDHLLSGEKSVQ
Ga0256899_1096058Ga0256899_10960581F098404TAMRSFLICVVLALAIACAAAQQTRPKLSETFESKGFVQIKHNGTLFFGEGWYHVSQPDGKALEAYAFGGAEHLNVYELQRFDKGKAFEVIHAGHDKTPICHTKSLTGKMPQLWDWVEKADYVRNFTANGSKFDLWGYKTAGITLEVAVPVGYPSILAYFGRFSAGNEFSYYIEQWKTDKPHSTWFEIPRECHLGPK
Ga0256899_1117648Ga0256899_11176481F096377KVAGKDRKYLKINNNSDLVQFQSKYKSTPLYFIPTDDNNVNIFITDNDAIINDILGQEDIIEDVVSKLFAKLDRNPTPFQEDLWLPIFSIKEKSIDLEAAKTLLKDEYKVNYATNTCTIGLNGSRVPGNLKVRPNEKSKIIEKPFLFGILHEQVDFPLFAVVVKPEDFAQHE
Ga0256899_1135088Ga0256899_11350881F054554FTAADDFLDRIKAWTDRYQDLINAEIKMLEKMNASASLASISSIFSTFSGAQNNVIQIRQQQLGKVIEYIQTPAKKFIGDQTPIRNKIDQTNKAWIELRYWKKKGGKHVEEEKNAQTAYDEHISALFRMFDTNIDAQVAQWVKYFADFEVEFFSNAANVAPRV

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.