Basic Information | |
---|---|
IMG/M Taxon OID | 3300028981 Open in IMG/M |
GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0127429 | Gp0193658 | Ga0169664 |
Sample Name | Human fecal microbial communities from newborn in Denmark - 345_B |
Sequencing Status | Permanent Draft |
Sequencing Center | Beijing Genomics Institute (BGI) |
Published? | Y |
Use Policy | Open |
Dataset Contents | |
---|---|
Total Genome Size | 218359261 |
Sequencing Scaffolds | 0 |
Novel Protein Genes | 1 |
Associated Families | 1 |
Dataset Phylogeny | |
---|---|
Taxonomy Groups | Number of Scaffolds |
Ecosystem Assignment (GOLD) | |
---|---|
Name | Cephalotes Ants Gut Microbiomes |
Type | Host-Associated |
Taxonomy | Host-Associated → Arthropoda → Digestive System → Gut → Unclassified → Ant Gut → Cephalotes Ants Gut Microbiomes |
Alternative Ecosystem Assignments | |
---|---|
Environment Ontology (ENVO) | Unclassified |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Animal → Animal distal gut |
Location Information | ||||||||
---|---|---|---|---|---|---|---|---|
Location | Denmark | |||||||
Coordinates | Lat. (o) | -19.11 | Long. (o) | 12.531 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F101356 | Metagenome | 102 | N |
Scaffold | Taxonomy | Length | IMG/M Link |
---|
Scaffold ID | Protein ID | Family | Sequence |
---|---|---|---|
Ga0169664_103436 | Ga0169664_1034363 | F101356 | MPVVTPEKDGLSNSKFATTKIKSEGKRSVLLYRSSSSQWAPFAIRVSCISTGEPLSDFCVYIAGNTMELQDSTKVYVKYLYGQPNSDTYLKMKYETDHRISIYLTSDNSLGDRTIVRELIVRDSMYDMATQDDEITGLADCTIVQ |
⦗Top⦘ |