 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300029015 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0127429 | Gp0193644 | Ga0169650 |
| Sample Name | Human fecal microbial communities from infant at 12 months in Denmark - 338_12M |
| Sequencing Status | Permanent Draft |
| Sequencing Center | Beijing Genomics Institute (BGI) |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 102113441 |
| Sequencing Scaffolds | 4 |
| Novel Protein Genes | 4 |
| Associated Families | 4 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1 |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium → Faecalibacterium prausnitzii | 1 |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 1 |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Human Host-Associated Microbial Communities From Fecal Samples Of Mother And Infant In Denmark |
| Type | Host-Associated |
| Taxonomy | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Host-Associated → Human Host-Associated Microbial Communities From Fecal Samples Of Mother And Infant In Denmark |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Animal → Animal distal gut |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Denmark | |||||||
| Coordinates | Lat. (o) | 55.678 | Long. (o) | 12.531 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F047125 | Metagenome / Metatranscriptome | 150 | N |
| F067720 | Metagenome | 125 | Y |
| F078693 | Metagenome | 116 | N |
| F089053 | Metagenome | 109 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0169650_100224 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 56111 | Open in IMG/M |
| Ga0169650_107259 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium → Faecalibacterium prausnitzii | 2368 | Open in IMG/M |
| Ga0169650_110496 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 1622 | Open in IMG/M |
| Ga0169650_126178 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 555 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0169650_100224 | Ga0169650_10022469 | F067720 | MTSTTYRHLGDVNKMYAAQEQFRDLTKMVCARFRDLTKTYHLGNVTVMVRNAGQLPQPFWLGAACGGGSHSLSASVARA |
| Ga0169650_107259 | Ga0169650_1072592 | F078693 | MVLAPVRGAERFYVKWNCSLLMSKENQKTTSDFDALDPRERGCSPLSDPKGEVETEKS |
| Ga0169650_110496 | Ga0169650_1104962 | F047125 | MDVALLLMVLGVMSSGFRAADALDHMREEIIRQEGKRRGWWS |
| Ga0169650_126178 | Ga0169650_1261781 | F089053 | MEGPRPDKFTFGVRIGRVVYECRTVKGCIRKWIYRSANGQPELSTAEEATVKNMEAFL |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |