Basic Information | |
---|---|
IMG/M Taxon OID | 3300029030 Open in IMG/M |
GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0127429 | Gp0193667 | Ga0169673 |
Sample Name | Human fecal microbial communities from mother in Denmark - 367_M |
Sequencing Status | Permanent Draft |
Sequencing Center | Beijing Genomics Institute (BGI) |
Published? | N |
Use Policy | Open |
Dataset Contents | |
---|---|
Total Genome Size | 120591751 |
Sequencing Scaffolds | 8 |
Novel Protein Genes | 8 |
Associated Families | 7 |
Dataset Phylogeny | |
---|---|
Taxonomy Groups | Number of Scaffolds |
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 2 |
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Rikenellaceae → Alistipes → Alistipes onderdonkii | 1 |
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium → Faecalibacterium prausnitzii | 1 |
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → unclassified Eubacteriales → Clostridiales bacterium VE202-28 | 1 |
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Veillonellales → Veillonellaceae → Veillonella → Veillonella tobetsuensis | 1 |
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 1 |
Not Available | 1 |
Ecosystem Assignment (GOLD) | |
---|---|
Name | Human Host-Associated Microbial Communities From Fecal Samples Of Mother And Infant In Denmark |
Type | Host-Associated |
Taxonomy | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Host-Associated → Human Host-Associated Microbial Communities From Fecal Samples Of Mother And Infant In Denmark |
Alternative Ecosystem Assignments | |
---|---|
Environment Ontology (ENVO) | Unclassified |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Animal → Animal distal gut |
Location Information | ||||||||
---|---|---|---|---|---|---|---|---|
Location | Denmark | |||||||
Coordinates | Lat. (o) | 55.678 | Long. (o) | 12.531 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F026592 | Metagenome / Metatranscriptome | 197 | Y |
F047125 | Metagenome / Metatranscriptome | 150 | N |
F054110 | Metagenome | 140 | N |
F055715 | Metagenome | 138 | N |
F067844 | Metagenome | 125 | N |
F076064 | Metagenome | 118 | N |
F090515 | Metagenome | 108 | N |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
Ga0169673_100930 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 14326 | Open in IMG/M |
Ga0169673_101357 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Rikenellaceae → Alistipes → Alistipes onderdonkii | 10319 | Open in IMG/M |
Ga0169673_102962 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium → Faecalibacterium prausnitzii | 5197 | Open in IMG/M |
Ga0169673_113310 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → unclassified Eubacteriales → Clostridiales bacterium VE202-28 | 1505 | Open in IMG/M |
Ga0169673_117626 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 1197 | Open in IMG/M |
Ga0169673_135584 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Veillonellales → Veillonellaceae → Veillonella → Veillonella tobetsuensis | 658 | Open in IMG/M |
Ga0169673_140376 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 592 | Open in IMG/M |
Ga0169673_149425 | Not Available | 500 | Open in IMG/M |
Scaffold ID | Protein ID | Family | Sequence |
---|---|---|---|
Ga0169673_100930 | Ga0169673_1009302 | F055715 | LTKANEFDKINELLIERTAKKFERASKNKLKKFLTNEKFCDKINELIRVGTAEILDN |
Ga0169673_101357 | Ga0169673_1013573 | F076064 | LKKTTPGRALENLFYLQYDLPPEASFHATTEEAKRPDELYMRKLLPELTRLKLQPRHVVANDEAYYAVMKGVMLFTPEAEKLMLTEDYFSVRRQIRLCAPDLKRRNEAKRPPKPALKFY |
Ga0169673_102962 | Ga0169673_1029621 | F026592 | SPQGIAALAAQGGVATLTERSDATFSVMQFSSADGE |
Ga0169673_113310 | Ga0169673_1133103 | F026592 | SPQGIAALAAQGGVATLTERSDATFFVGQFSSADRE |
Ga0169673_117626 | Ga0169673_1176263 | F067844 | MNTLAAETASAWYLILNRKRPPKRAVASYFNMTQFSSHLPRPLTMGTQQVSAGAA |
Ga0169673_135584 | Ga0169673_1355842 | F054110 | VNYQPTIKKLLKALQMNGRRYVVDVRQSWSKYDKPCKVYIVNRMYTEEEYKLTFPHKYKKGKTFKQGQLYKKESEYSSTKQHEVLLFLVKTYKGGD |
Ga0169673_140376 | Ga0169673_1403762 | F047125 | MDVALLLMVLGVMLSGFRAADALDYMRKEILRQEGKRRGWWS |
Ga0169673_149425 | Ga0169673_1494251 | F090515 | VTTCCKAGPKAALQGTAPGRVACLEFAGGEKRKTNIAADYAVKALTFTALLCRHIGSIRTFLKS |
⦗Top⦘ |