Sample 3300029297

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Sample 3300029297

3300029297: Mouse gut microbial communities from Hong Kong to study the effect of probiotic LGG - LGG W0

Overview

Basic Information
IMG/M Taxon OID	3300029297 Open in IMG/M
GOLD Reference (Study \| Sequencing Project \| Analysis Project)	Gs0121305 \| Gp0151713 \| Ga0134541
Sample Name	Mouse gut microbial communities from Hong Kong to study the effect of probiotic LGG - LGG W0
Sequencing Status	Permanent Draft
Sequencing Center	University of Hong Kong
Published?	N
Use Policy	Open

Dataset Contents
Total Genome Size	215950181
Sequencing Scaffolds	1
Novel Protein Genes	1
Associated Families	1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
Not Available	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
Name	Mouse Gut Microbial Communities From Hong Kong To Study The Effect Of Probiotic Lgg
Type	Host-Associated
Taxonomy	Host-Associated → Mammals → Digestive System → Unclassified → Unclassified → Mouse Gut → Mouse Gut Microbial Communities From Hong Kong To Study The Effect Of Probiotic Lgg

Alternative Ecosystem Assignments
Environment Ontology (ENVO)	Unclassified
Earth Microbiome Project Ontology (EMPO)	Host-associated → Animal → Animal proximal gut

Location Information
Location	Hong Kong
Coordinates	Lat. (^o)	22.3356	Long. (^o)	114.1826	Alt. (m)	N/A	Depth (m)	N/A
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F099451	Metagenome	103	N

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
Ga0134541_1001654	Not Available	11132	Open in IMG/M

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0134541_1001654	Ga0134541_100165423	F099451	MSEIKTVGDLRKVIANLDDSFKIEMRIRRKLTDEELKYMPYPYPYETEYSTLEFDDIGYSDKELCLGVERGQNNE

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.